(data stored in SCRATCH zone)

EMBL: AL009126.YDBC

AL009126.YDBC        Location/Qualifiers
FT   CDS             495344..495703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbC"
FT                   /locus_tag="BSU_04420"
FT                   /old_locus_tag="BSU04420"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04420"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12249"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR032555"
FT                   /db_xref="SubtiList:BG12070"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96598"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12249.1"
FT                   /translation="MLIKKMICEVDAANAEAFAKAQSQWEALSHISGFIKQAGGWRKTI
FT                   DEPLTAEIISVWENREAYDHFMENEHDSIYEENDQKAVILSIEVTVYEEDKPFVHDLLH
FT                   NPDIRYEPNWTVLKA"
     MLIKKMICEV DAANAEAFAK AQSQWEALSH ISGFIKQAGG WRKTIDEPLT AEIISVWENR        60
     EAYDHFMENE HDSIYEENDQ KAVILSIEVT VYEEDKPFVH DLLHNPDIRY EPNWTVLKA        119
//

If you have problems or comments...

PBIL Back to PBIL home page