(data stored in ACNUC7421 zone)

EMBL: AL009126.YDBD

AL009126.YDBD        Location/Qualifiers
FT   CDS             complement(495740..496561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbD"
FT                   /locus_tag="BSU_04430"
FT                   /old_locus_tag="BSU04430"
FT                   /product="putative manganese-containing catalase"
FT                   /function="16.8: Protect"
FT                   /EC_number="1.11.1.6"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15231799; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04430"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12250"
FT                   /db_xref="GOA:P80878"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR027407"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="SubtiList:BG12071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80878"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12250.1"
FT                   /translation="MFKHTKMLQHPAKPDRPDPLFAKKMQEILGGQFGEISVAMQYLFQ
FT                   GWNTRGNEKYKDLLMDTATEELGHVEMIATMIARLLEDAPLDQQEKAAEDPVIGSILGG
FT                   MNPHHAIVSGLGAMPESSTGVPWSGGYIVASGNLLADFRANLNAESQGRLQVARLFEMT
FT                   DDKGVKDMLSFLLARDTMHQNQWLAAIKELEAQEGPVVPGTFPKALEKQEFSHQLINFS
FT                   EGEVSAEQNWLNEKAPDGEAFEYVKEAKTFGEKPELKPAPPFVHNTLPGRE"
     MFKHTKMLQH PAKPDRPDPL FAKKMQEILG GQFGEISVAM QYLFQGWNTR GNEKYKDLLM        60
     DTATEELGHV EMIATMIARL LEDAPLDQQE KAAEDPVIGS ILGGMNPHHA IVSGLGAMPE       120
     SSTGVPWSGG YIVASGNLLA DFRANLNAES QGRLQVARLF EMTDDKGVKD MLSFLLARDT       180
     MHQNQWLAAI KELEAQEGPV VPGTFPKALE KQEFSHQLIN FSEGEVSAEQ NWLNEKAPDG       240
     EAFEYVKEAK TFGEKPELKP APPFVHNTLP GRE                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page