(data stored in ACNUC7421 zone)

EMBL: AL009126.YDBJ

AL009126.YDBJ        Location/Qualifiers
FT   CDS             502908..503834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbJ"
FT                   /locus_tag="BSU_04490"
FT                   /old_locus_tag="BSU04490"
FT                   /product="putative ABC transporter (ATP-binding subunit)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04490"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12256"
FT                   /db_xref="GOA:P96605"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG12077"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96605"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12256.1"
FT                   /translation="MAEPILHIEGLDKKIGSKQILKQISMDVMEGEIIGLLGPNGSGKT
FT                   TLIRIIVGLLKQNSGSVTISGFQHDTEFEKAMEAVGAIVENPEFYPYLTGWENLKHFAN
FT                   MHKKIADERLDEVVERVGLTSAIHDKVKTYSLGMRQRLGIAQAILHRPKLLILDEPTNG
FT                   LDPAGMKDFRDHIKELAEMEGTAVLFATHLLREVEDLCDRVIIIQKGEIKAEVSLQGTD
FT                   QTTEKAIIEVQPQEKALNWLTGNQYQAESQDGTIVVEVAKENIPELNRSLVGQDLNVFS
FT                   ITPYTQSLEDEFIKATTAHQEEGEELV"
     MAEPILHIEG LDKKIGSKQI LKQISMDVME GEIIGLLGPN GSGKTTLIRI IVGLLKQNSG        60
     SVTISGFQHD TEFEKAMEAV GAIVENPEFY PYLTGWENLK HFANMHKKIA DERLDEVVER       120
     VGLTSAIHDK VKTYSLGMRQ RLGIAQAILH RPKLLILDEP TNGLDPAGMK DFRDHIKELA       180
     EMEGTAVLFA THLLREVEDL CDRVIIIQKG EIKAEVSLQG TDQTTEKAII EVQPQEKALN       240
     WLTGNQYQAE SQDGTIVVEV AKENIPELNR SLVGQDLNVF SITPYTQSLE DEFIKATTAH       300
     QEEGEELV                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page