(data stored in SCRATCH zone)

EMBL: AL009126.YDBL

AL009126.YDBL        Location/Qualifiers
FT   CDS             504689..505024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbL"
FT                   /locus_tag="BSU_04510"
FT                   /old_locus_tag="BSU04510"
FT                   /product="putative glyco-prenyl flippase subunit"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 17928292; Product type
FT                   t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04510"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12258"
FT                   /db_xref="GOA:P96607"
FT                   /db_xref="SubtiList:BG12079"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96607"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12258.1"
FT                   /translation="MRNFITALPIVLLLGFSFVSFMFQFEHLVYFRLALGLFSLVGLYM
FT                   IYKMKTGIRYFIIYLYASWIVLAAVTAFEEPIFSSFFFGGLVMTMGYLTYMLIYLGMKQ
FT                   DRDANPV"
     MRNFITALPI VLLLGFSFVS FMFQFEHLVY FRLALGLFSL VGLYMIYKMK TGIRYFIIYL        60
     YASWIVLAAV TAFEEPIFSS FFFGGLVMTM GYLTYMLIYL GMKQDRDANP V                111
//

If you have problems or comments...

PBIL Back to PBIL home page