(data stored in SCRATCH zone)

EMBL: AL009126.YDZK

AL009126.YDZK        Location/Qualifiers
FT   CDS             complement(490777..491043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydzK"
FT                   /locus_tag="BSU_04359"
FT                   /old_locus_tag="BSU04359"
FT                   /product="putative membrane protein"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type m: membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04359"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52551"
FT                   /db_xref="GOA:C0H3V4"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3V4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX52551.1"
FT                   /translation="MSVFILFYLWIVPIVIGILCSVAAHKSKGKMRVAPGIAMIVLSII
FT                   SLITAFTAGHTNFHVFIGGMFLFGTFLVGSAFPFFFGLKKKEK"
     MSVFILFYLW IVPIVIGILC SVAAHKSKGK MRVAPGIAMI VLSIISLITA FTAGHTNFHV        60
     FIGGMFLFGT FLVGSAFPFF FGLKKKEK                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page