(data stored in ACNUC7421 zone)

EMBL: AL009126.ZNUC

AL009126.ZNUC        Location/Qualifiers
FT   CDS             309347..310042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuC"
FT                   /locus_tag="BSU_02860"
FT                   /old_locus_tag="BSU02860"
FT                   /product="Zn(II) transporter (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9379902, 9811636, 21813502;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02860"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12080"
FT                   /db_xref="GOA:O34946"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG12764"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34946"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9379902, 9811636, 21813502"
FT                   /protein_id="CAB12080.1"
FT                   /translation="MNLVSLKDIVFGYSHTPVLDKVSLDIESGEFVGITGPNGASKSTL
FT                   IKVMLGMLKPWEGTVTISKRNTEGKRLTIGYVPQQISSFNAGFPSTVLELVQSGRYTKG
FT                   KWFKRLNEEDHLEVEKALKMVEMWDLRHRKIGDLSGGQKQKICIARMLASNPDLLMLDE
FT                   PTTAVDYDSRKGFYEFMHHLVKNHNRTVVMVTHEQNEVQQFLDKVIRLERGEKGGWKCL
FT                   TWNSCDELF"
     MNLVSLKDIV FGYSHTPVLD KVSLDIESGE FVGITGPNGA SKSTLIKVML GMLKPWEGTV        60
     TISKRNTEGK RLTIGYVPQQ ISSFNAGFPS TVLELVQSGR YTKGKWFKRL NEEDHLEVEK       120
     ALKMVEMWDL RHRKIGDLSG GQKQKICIAR MLASNPDLLM LDEPTTAVDY DSRKGFYEFM       180
     HHLVKNHNRT VVMVTHEQNE VQQFLDKVIR LERGEKGGWK CLTWNSCDEL F                231
//

If you have problems or comments...

PBIL Back to PBIL home page