(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26310

AL161565.AT4G26310   Location/Qualifiers
FT   CDS             complement(join(11284..11361,11487..11526,11704..11827,
FT                   12412..12481,12598..12648,12741..12754,12843..12873,
FT                   13014..13244))
FT                   /gene="AT4g26310"
FT                   /product="putative protein"
FT                   /note="similarity to elongation factor P (efp) RP238,
FT                   Rickettsia prowazekii, PIR2:B71678"
FT                   /note="Contains Elongation factor P signature
FT                   AA176-195;Prokaryotic membrane lipoprotein lipid attachment
FT                   site AA42-52"
FT                   /note="contains EST gb:F20046"
FT                   /db_xref="GOA:Q9STQ4"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:Q9STQ4"
FT                   /protein_id="CAB79486.1"
FT                   /translation="MRGLHHFKRISISRSLFSFSNATSPGAVTTRRSLYSLSRSLLSST
FT                   PYAAGGCCRETPPLHSPWSALQRRGVKVNAIQLRAGNVIERTGRTFRVVEAEHKQQGRG
FT                   GASIQVELRDVDTGNKLNLRFGSEESVEKEMKVQLQLYDGRALSASIPKHITCTVVETQ
FT                   LPMKGLTSAPRYKRALLDNGSTIQVPSYLEAGEKIVINTEDDSFVKRYY"
     MRGLHHFKRI SISRSLFSFS NATSPGAVTT RRSLYSLSRS LLSSTPYAAG GCCRETPPLH        60
     SPWSALQRRG VKVNAIQLRA GNVIERTGRT FRVVEAEHKQ QGRGGASIQV ELRDVDTGNK       120
     LNLRFGSEES VEKEMKVQLQ LYDGRALSAS IPKHITCTVV ETQLPMKGLT SAPRYKRALL       180
     DNGSTIQVPS YLEAGEKIVI NTEDDSFVKR YY                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page