(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26320

AL161565.AT4G26320   Location/Qualifiers
FT   CDS             complement(14413..14592)
FT                   /gene="AT4g26320"
FT                   /product="putative protein"
FT                   /note="contains EST gb:T44583"
FT                   /db_xref="GOA:Q9STQ3"
FT                   /db_xref="InterPro:IPR039281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STQ3"
FT                   /protein_id="CAB79487.1"
FT                   /translation="MEAMKMRLFVAVLVAAMAFSAVQQAAAVEAPAPSPTSDASLAIPA
FT                   FFASVATLAFGFLF"
     MEAMKMRLFV AVLVAAMAFS AVQQAAAVEA PAPSPTSDAS LAIPAFFASV ATLAFGFLF         59
//

If you have problems or comments...

PBIL Back to PBIL home page