(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26340

AL161565.AT4G26340   Location/Qualifiers
FT   CDS             join(21308..22144,22450..22737)
FT                   /gene="AT4g26340"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="GOA:Q8H1R7"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006566"
FT                   /db_xref="InterPro:IPR013101"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8H1R7"
FT                   /protein_id="CAB79489.1"
FT                   /translation="MDRISQLSDDLLLQILSFIPGKDVVATSLLSKRWQSLWMLVSELE
FT                   YDDSYHTGDYKSFSQFVYRSLLSNNAPVIKHLHLNLGPDCPAIDIGLWIGFALTRRLRQ
FT                   LKINIRTSSNDASFSLPSSLYTSDTLETLRLINFVLLDVPSSVCLPSLKVLHLKTVDYE
FT                   DDASLPSLLFGCPNLEELFVERHDQDLEMDVTFVVPSLRRLSMIDKNYGQCDRYVIDVP
FT                   SLKYLNITDDAVYDVRQIENMPELVEAHVDITQGVTHKFLRALTSVRQLSLCLSLSEKQ
FT                   HESGLCGIETPIGWKLPSSVPECLLFSLEAFEWIGYKGRRGDREVATYVLKNAACLRTA
FT                   KFSPESTDVGEKYHMLKELASVPTASTSSKLLFD"
     MDRISQLSDD LLLQILSFIP GKDVVATSLL SKRWQSLWML VSELEYDDSY HTGDYKSFSQ        60
     FVYRSLLSNN APVIKHLHLN LGPDCPAIDI GLWIGFALTR RLRQLKINIR TSSNDASFSL       120
     PSSLYTSDTL ETLRLINFVL LDVPSSVCLP SLKVLHLKTV DYEDDASLPS LLFGCPNLEE       180
     LFVERHDQDL EMDVTFVVPS LRRLSMIDKN YGQCDRYVID VPSLKYLNIT DDAVYDVRQI       240
     ENMPELVEAH VDITQGVTHK FLRALTSVRQ LSLCLSLSEK QHESGLCGIE TPIGWKLPSS       300
     VPECLLFSLE AFEWIGYKGR RGDREVATYV LKNAACLRTA KFSPESTDVG EKYHMLKELA       360
     SVPTASTSSK LLFD                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page