(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26350

AL161565.AT4G26350   Location/Qualifiers
FT   CDS             join(24031..24897,24977..25111,25200..25493)
FT                   /gene="AT4g26350"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="GOA:Q9STQ0"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006566"
FT                   /db_xref="InterPro:IPR013101"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STQ0"
FT                   /protein_id="CAB79490.1"
FT                   /translation="MDIISQCPDHLLLRILSFIPTKDVIVTSLLSKRWGSLWRWVPKLE
FT                   YDFTRQNMRFVKFVYRSLLQNNAPVLESLHLKNIILYAECRTVDIGGWIDIAVSRRVRE
FT                   LEISINCSDEKFRLPSSLYTCGTLESFILTIKHCHLVDVPLAVCLPSLKKLHLRCIGWA
FT                   YNATLLRLISGCTNLEELRLARPDDDGDYIMIHEAGSTIDYMSIFERRYMFEFMFDQMF
FT                   GKGSSNGINAPLKYFSISNNYRIHNFRGIEKMPDWVEARIAVTGGSHKYLKEITYAKGL
FT                   YVCLSVSEVMNPYDMIFHMLVDLTICTCTQGWWDLLTHMLQGSPKLRFLTLTNDHCREL
FT                   PSLETPACWKRPSSVPACLLSSLQAFTWSGYKGRQGDKEVVKYVLRNATGLKKRIFISK
FT                   SNDFGEKFCMLQELASVPTPSPSCQLLFDRIF"
     MDIISQCPDH LLLRILSFIP TKDVIVTSLL SKRWGSLWRW VPKLEYDFTR QNMRFVKFVY        60
     RSLLQNNAPV LESLHLKNII LYAECRTVDI GGWIDIAVSR RVRELEISIN CSDEKFRLPS       120
     SLYTCGTLES FILTIKHCHL VDVPLAVCLP SLKKLHLRCI GWAYNATLLR LISGCTNLEE       180
     LRLARPDDDG DYIMIHEAGS TIDYMSIFER RYMFEFMFDQ MFGKGSSNGI NAPLKYFSIS       240
     NNYRIHNFRG IEKMPDWVEA RIAVTGGSHK YLKEITYAKG LYVCLSVSEV MNPYDMIFHM       300
     LVDLTICTCT QGWWDLLTHM LQGSPKLRFL TLTNDHCREL PSLETPACWK RPSSVPACLL       360
     SSLQAFTWSG YKGRQGDKEV VKYVLRNATG LKKRIFISKS NDFGEKFCML QELASVPTPS       420
     PSCQLLFDRI F                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page