(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26360

AL161565.AT4G26360   Location/Qualifiers
FT   CDS             complement(join(25941..26124,26238..26826,26859..28122,
FT                   28165..29553))
FT                   /gene="AT4g26360"
FT                   /product="putative protein"
FT                   /note="similarity to RNA-directed DNA polymerase,
FT                   Arabidopsis thaliana retrotransposon Ta11-1, PIR2:S65812"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA787-797"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:O65598"
FT                   /protein_id="CAB79491.1"
FT                   /translation="MSCGFNIPSHRNGFKKWFKVNRPIFGGVIEKHVKQPKDKKFINAL
FT                   LPGWFFDENYGFSDLGKIWVLWDPSVEVVIVAKSLQMITCEVLFPNSRTWIVISVVYAA
FT                   NEDDKRKELWREITALVASPVTFNRPWILLGDFNQVLHPHEHSRHVSLNVDRRIRDFRE
FT                   CLLDAELSDLVYKGSSFTWWNKSKTRPVAKKIDRILVNESWSNLFPSSFGLFGPPDFSD
FT                   HASCGVVLELDPIKAKRPFKFFNFLLKNPEFLNLVWDVWYSTNVVGSSMFRVSKKLKAL
FT                   KKPIKDFSRLNYSNLEKRTEEAHETLLSFQNLTLDNPSLENAAHELEAQRKWQILATAE
FT                   ESFFRQRSRVTWFAEGDGNTRYFHRMADSRKSVNTITTLVDDSGTQIDSQQGIADHCAL
FT                   YFENLLSDDNDPYSLEQDDMNLLLTYRCPYSQVADLEAMFSDEDIKAAFFGLPSNKACG
FT                   PDGFPVTAAVREFFISGNLLKQWNATTIVLIPKFPNASCTSDFRPISCMNTLYKVIARL
FT                   LTDRLQKLLSCVISPSQSAFLPGRLLAENVLLATEMVHGYNWRNISLRGMLKVDLRKAF
FT                   DSVRWEFIIAALLALGVPTKFINWIHQCISTPTFTVSVNGCCGGFFKSAKGLRQGDPLS
FT                   PYLFVLAMEVFSKLLNSRFDSGYIRYHPKASDLSISHLMFADDVMIFFDGGSSSLHGIC
FT                   ETLEDFASWSGLKVNNDKSHFFCAGLEQAERNSLAAYGFPQGCLPIRYLGLPLMCRKLR
FT                   IAEYEPLLEKSPKNSDHGQQIVYLTQVEFNLLLPLSMVSSTFGCPLSCCQRVALRRLKA
FT                   FVLGSFERETLMVVEEQRSLGLLFASQKMKVGLALEDSPSGTKRFVCVLFGFSLIIKVR
FT                   FGFLGTLITILEADPWSWRMLLFLRPLAEQFVKCNLGNGRIAHFWHDSWTSLGPLIKVM
FT                   GDYGSRSLRIPLNARVVEALGVNGWKLPLSRSAPAQAIHEHISTIMTPSPATIEDSFDW
FT                   VVGGVVCQGSLRQGLGMLLDQEHRNWTGQRLFGSRVLFLSMPSTCGLVSWIDSQLVKGL
FT                   PLGAISSLSIVAYALLRLSPETISFFPVNLRLRKVSAHAIIYNIWRQRNNVLHNNLRIA
FT                   PLIIFKIVDREIRNIISSRYHRKRWRNLMVLWIR"
     MSCGFNIPSH RNGFKKWFKV NRPIFGGVIE KHVKQPKDKK FINALLPGWF FDENYGFSDL        60
     GKIWVLWDPS VEVVIVAKSL QMITCEVLFP NSRTWIVISV VYAANEDDKR KELWREITAL       120
     VASPVTFNRP WILLGDFNQV LHPHEHSRHV SLNVDRRIRD FRECLLDAEL SDLVYKGSSF       180
     TWWNKSKTRP VAKKIDRILV NESWSNLFPS SFGLFGPPDF SDHASCGVVL ELDPIKAKRP       240
     FKFFNFLLKN PEFLNLVWDV WYSTNVVGSS MFRVSKKLKA LKKPIKDFSR LNYSNLEKRT       300
     EEAHETLLSF QNLTLDNPSL ENAAHELEAQ RKWQILATAE ESFFRQRSRV TWFAEGDGNT       360
     RYFHRMADSR KSVNTITTLV DDSGTQIDSQ QGIADHCALY FENLLSDDND PYSLEQDDMN       420
     LLLTYRCPYS QVADLEAMFS DEDIKAAFFG LPSNKACGPD GFPVTAAVRE FFISGNLLKQ       480
     WNATTIVLIP KFPNASCTSD FRPISCMNTL YKVIARLLTD RLQKLLSCVI SPSQSAFLPG       540
     RLLAENVLLA TEMVHGYNWR NISLRGMLKV DLRKAFDSVR WEFIIAALLA LGVPTKFINW       600
     IHQCISTPTF TVSVNGCCGG FFKSAKGLRQ GDPLSPYLFV LAMEVFSKLL NSRFDSGYIR       660
     YHPKASDLSI SHLMFADDVM IFFDGGSSSL HGICETLEDF ASWSGLKVNN DKSHFFCAGL       720
     EQAERNSLAA YGFPQGCLPI RYLGLPLMCR KLRIAEYEPL LEKSPKNSDH GQQIVYLTQV       780
     EFNLLLPLSM VSSTFGCPLS CCQRVALRRL KAFVLGSFER ETLMVVEEQR SLGLLFASQK       840
     MKVGLALEDS PSGTKRFVCV LFGFSLIIKV RFGFLGTLIT ILEADPWSWR MLLFLRPLAE       900
     QFVKCNLGNG RIAHFWHDSW TSLGPLIKVM GDYGSRSLRI PLNARVVEAL GVNGWKLPLS       960
     RSAPAQAIHE HISTIMTPSP ATIEDSFDWV VGGVVCQGSL RQGLGMLLDQ EHRNWTGQRL      1020
     FGSRVLFLSM PSTCGLVSWI DSQLVKGLPL GAISSLSIVA YALLRLSPET ISFFPVNLRL      1080
     RKVSAHAIIY NIWRQRNNVL HNNLRIAPLI IFKIVDREIR NIISSRYHRK RWRNLMVLWI      1140
     R                                                                      1141
//

If you have problems or comments...

PBIL Back to PBIL home page