(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26370

AL161565.AT4G26370   Location/Qualifiers
FT   CDS             complement(join(31277..31414,31516..31614,31885..31972,
FT                   32065..32119,32257..32391,32557..32633,33018..33255,
FT                   33301..33331))
FT                   /gene="AT4g26370"
FT                   /product="putative protein"
FT                   /note="similarity to transcription termination factor nusB,
FT                   Synechocystis sp., PIR2:S76233"
FT                   /db_xref="GOA:O65597"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:O65597"
FT                   /protein_id="CAB79492.1"
FT                   /translation="MEGTFSPLCLHSHRSIGFTLVDSLRPTNLVSLRTGNKRSSSSSLR
FT                   LFLSPTRSALRTPTISAEEVKDVPMPKIDKSGRLSSPRAARELALVILYAACLEGSDPI
FT                   RLFEKRINARREPGYEFDKSSLLEYNHMSFGGPPVKTETKEEEDELVRHDEKESKIEAE
FT                   VLSAPPKLVYSKLVLRFAKKLLAAVVDKWDSHVVIIEKISPPDWKSAPAGRILEFSILH
FT                   LAMSEVAVLETRHPIVINEAVDLAKRFCDGSAPRIINGCLRTFVKDRATTSTPQALELK
FT                   QEVSV"
     MEGTFSPLCL HSHRSIGFTL VDSLRPTNLV SLRTGNKRSS SSSLRLFLSP TRSALRTPTI        60
     SAEEVKDVPM PKIDKSGRLS SPRAARELAL VILYAACLEG SDPIRLFEKR INARREPGYE       120
     FDKSSLLEYN HMSFGGPPVK TETKEEEDEL VRHDEKESKI EAEVLSAPPK LVYSKLVLRF       180
     AKKLLAAVVD KWDSHVVIIE KISPPDWKSA PAGRILEFSI LHLAMSEVAV LETRHPIVIN       240
     EAVDLAKRFC DGSAPRIING CLRTFVKDRA TTSTPQALEL KQEVSV                      286
//

If you have problems or comments...

PBIL Back to PBIL home page