(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26380

AL161565.AT4G26380   Location/Qualifiers
FT   CDS             join(35256..38212,38645..38738)
FT                   /gene="AT4g26380"
FT                   /product="hypothetical protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /note="contains EST gb:AA651112"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR004146"
FT                   /db_xref="UniProtKB/TrEMBL:O65596"
FT                   /protein_id="CAB79493.1"
FT                   /translation="MDSESELMISLISQLLSILGGGEDTHTPQLKSKLIALTCQLISLV
FT                   NSLDLDSQPEPESKLKSLIKQIIYVSNSVSEPGPESQSVSVVTKMISIIGSIDFDLKES
FT                   EPELMSLTSQIFALIMAMDEESELFSLLSEVASLVQTEEQKLINNQQVPPLTTEEEEKD
FT                   DLIYGYTDDMNWESELMFYIISKMISTLRGEDMCQEVARDFIAYANQLIPLIESLDMDS
FT                   NSEPKQEPKITSLVRQIISLSKVVSGPESQLVSLVTRIISITSSTDLDPTESQWRLTSV
FT                   TYKISRILKEIKDSEDSEMASLINQIHDLVDAEEGRKPESRLISSITQLMSHINSWSFY
FT                   SGMDPKIISLIIRIIYLVRSMDLDSQTKPKSELMSLVTQTIAVYNSMDLDSQPRPLRKV
FT                   VSVFSQYGFDVNSTVSDSESDSSENYVSHIKDSLKLEPEPELISFIHRIGSLVISMNPN
FT                   WEKLISFCPQFEVILSDDGKFQVEEGRLSKNQLSDDIPMKWNCLQVNWNLLKLHAGEKD
FT                   FTHFRCRGCNGDNHKENEKAPLEVKHPLHPKHPLQLVLSQSSGGRTRECYCCDEDLLHI
FT                   FYCCLACNFSMNVACTKKPAVLYRNHPRWHEHTLALFPRQASLTCNLCALADSSSPIYM
FT                   CPPCDFVVHLRCTGLPRVIKISRHLHRISFTFSFDRGDLSCSVCRRKIDEDYGGYTCIK
FT                   DGCSYAAHSKCATQKNVWDGIELEGEPEEVEEEVVDPFVTISDGVIQHFGHPQHHLRLD
FT                   ENTSRDYDEDKLCQACVMPIYFGNFYSCTQCNYILHEACANFSRKMHHPVHPHVLTLVN
FT                   SDGAINVRKECAACPWMCTTGFFYECSKEDFQLHVQCANLSEPLVHESHMHPLFLTSKP
FT                   GERRLCSACKESYFSVTRETFNCIECDFALCFRCATLPQKVRYKHDKHMLTLSYGEETS
FT                   TMTYWCEVCERNLNPKERFYKCDEYCSITLHIECMLGVALYIRPGSSWICFNNKKILIK
FT                   MKAKKVAYTGIEPVTFALLARRSNQLS"
     MDSESELMIS LISQLLSILG GGEDTHTPQL KSKLIALTCQ LISLVNSLDL DSQPEPESKL        60
     KSLIKQIIYV SNSVSEPGPE SQSVSVVTKM ISIIGSIDFD LKESEPELMS LTSQIFALIM       120
     AMDEESELFS LLSEVASLVQ TEEQKLINNQ QVPPLTTEEE EKDDLIYGYT DDMNWESELM       180
     FYIISKMIST LRGEDMCQEV ARDFIAYANQ LIPLIESLDM DSNSEPKQEP KITSLVRQII       240
     SLSKVVSGPE SQLVSLVTRI ISITSSTDLD PTESQWRLTS VTYKISRILK EIKDSEDSEM       300
     ASLINQIHDL VDAEEGRKPE SRLISSITQL MSHINSWSFY SGMDPKIISL IIRIIYLVRS       360
     MDLDSQTKPK SELMSLVTQT IAVYNSMDLD SQPRPLRKVV SVFSQYGFDV NSTVSDSESD       420
     SSENYVSHIK DSLKLEPEPE LISFIHRIGS LVISMNPNWE KLISFCPQFE VILSDDGKFQ       480
     VEEGRLSKNQ LSDDIPMKWN CLQVNWNLLK LHAGEKDFTH FRCRGCNGDN HKENEKAPLE       540
     VKHPLHPKHP LQLVLSQSSG GRTRECYCCD EDLLHIFYCC LACNFSMNVA CTKKPAVLYR       600
     NHPRWHEHTL ALFPRQASLT CNLCALADSS SPIYMCPPCD FVVHLRCTGL PRVIKISRHL       660
     HRISFTFSFD RGDLSCSVCR RKIDEDYGGY TCIKDGCSYA AHSKCATQKN VWDGIELEGE       720
     PEEVEEEVVD PFVTISDGVI QHFGHPQHHL RLDENTSRDY DEDKLCQACV MPIYFGNFYS       780
     CTQCNYILHE ACANFSRKMH HPVHPHVLTL VNSDGAINVR KECAACPWMC TTGFFYECSK       840
     EDFQLHVQCA NLSEPLVHES HMHPLFLTSK PGERRLCSAC KESYFSVTRE TFNCIECDFA       900
     LCFRCATLPQ KVRYKHDKHM LTLSYGEETS TMTYWCEVCE RNLNPKERFY KCDEYCSITL       960
     HIECMLGVAL YIRPGSSWIC FNNKKILIKM KAKKVAYTGI EPVTFALLAR RSNQLS          1016
//

If you have problems or comments...

PBIL Back to PBIL home page