(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26390

AL161565.AT4G26390   Location/Qualifiers
FT   CDS             join(39385..39603,40235..40696,40784..41596)
FT                   /gene="AT4g26390"
FT                   /product="pyruvate kinase like protein"
FT                   /note="strong similarity to pyruvate kinase, Nicotiana
FT                   tabacum, PIR2:S41379"
FT                   /note="Contains Pyruvate kinase active site signature
FT                   AA222-234"
FT                   /note="contains EST gb:T46063, AA713162, T76023, AA404815,
FT                   AB015097, F20011, AA042524"
FT                   /db_xref="GOA:O65595"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:O65595"
FT                   /protein_id="CAB79494.1"
FT                   /translation="MAMEQRPKTKIVCTLGPASRSVPMVEKLLMAGMSVARFNFSHGSY
FT                   EYHQETLDNLRQAMLNTGMLCAVMLDTKGPEIRTGFLKDGKPIQLKQGQEITISTDYDL
FT                   KGDEKTICMSYKKLAQDVNPGMVILCADGTISLKVLSCDKEKGTVRCRCENTSMLGERK
FT                   NVNLPGVVVDLPTLTEKDKQDILEWGVPNQIDMIALSFVRKGSDLVQVRKLLGKHAKTI
FT                   LLMSKVENQEGVANFDDILINSDAFMIARGDLGMEIPIEKIFLAQKVMIYKCNFMGKPV
FT                   VTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGETAAGAYPELAVRTMAKICV
FT                   EAESTLDYGDIFKRIMLHAAVPMSPMESLASSAVRTATSSRATLMMVLTRGGSTARLVA
FT                   KYRPGIPILSVVVPEITSDSFDWACSNEAPARHSLIYRGLVPVLYAGSARASIDESTEE
FT                   TLEFASEYGKKKQLCKTGDSVVALFRTGNAIVIKILTVK"
     MAMEQRPKTK IVCTLGPASR SVPMVEKLLM AGMSVARFNF SHGSYEYHQE TLDNLRQAML        60
     NTGMLCAVML DTKGPEIRTG FLKDGKPIQL KQGQEITIST DYDLKGDEKT ICMSYKKLAQ       120
     DVNPGMVILC ADGTISLKVL SCDKEKGTVR CRCENTSMLG ERKNVNLPGV VVDLPTLTEK       180
     DKQDILEWGV PNQIDMIALS FVRKGSDLVQ VRKLLGKHAK TILLMSKVEN QEGVANFDDI       240
     LINSDAFMIA RGDLGMEIPI EKIFLAQKVM IYKCNFMGKP VVTATQMLES MIKSPRPTRA       300
     EATDVANAVL DGTDCVMLSG ETAAGAYPEL AVRTMAKICV EAESTLDYGD IFKRIMLHAA       360
     VPMSPMESLA SSAVRTATSS RATLMMVLTR GGSTARLVAK YRPGIPILSV VVPEITSDSF       420
     DWACSNEAPA RHSLIYRGLV PVLYAGSARA SIDESTEETL EFASEYGKKK QLCKTGDSVV       480
     ALFRTGNAIV IKILTVK                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page