(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26400

AL161565.AT4G26400   Location/Qualifiers
FT   CDS             complement(42131..43165)
FT                   /gene="AT4g26400"
FT                   /product="putative protein"
FT                   /note="similarity to RING zinc finger protein, Gallus
FT                   gallus"
FT                   /note="contains EST gb:Z34755, N65737"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:O65594"
FT                   /protein_id="CAB79495.1"
FT                   /translation="MVNPVIGAEIKCPFCQSGFVEEMSREINGGSSSSLREVQDPEIDF
FT                   GTDRALSLWGPILLGMMSNPRRRRRFRRTEFGVDNDEVNVSDDVDGNDSVDIDRHHHRR
FT                   HRHRQQGREIDLDREFESILRRRRRSSATILQLLQGIRAGIASEYESSDRDLLNQSAVV
FT                   QGSTSLNQNRNNTSLSAIGDYFVGSSLDHLLEHLADNDSIRHGSLPARKEVVDNLPTVK
FT                   ISESLQCSICLDDFDKGSEAKEMPCKHKFHIRCIVPWLELHSSCPVCRYELPPDDETKV
FT                   NPVRPRTRTLEINVSNENVEDDARNSNVSERRFSFPWPFSGLFSSSSSSSASASGSSHL
FT                   GENS"
     MVNPVIGAEI KCPFCQSGFV EEMSREINGG SSSSLREVQD PEIDFGTDRA LSLWGPILLG        60
     MMSNPRRRRR FRRTEFGVDN DEVNVSDDVD GNDSVDIDRH HHRRHRHRQQ GREIDLDREF       120
     ESILRRRRRS SATILQLLQG IRAGIASEYE SSDRDLLNQS AVVQGSTSLN QNRNNTSLSA       180
     IGDYFVGSSL DHLLEHLADN DSIRHGSLPA RKEVVDNLPT VKISESLQCS ICLDDFDKGS       240
     EAKEMPCKHK FHIRCIVPWL ELHSSCPVCR YELPPDDETK VNPVRPRTRT LEINVSNENV       300
     EDDARNSNVS ERRFSFPWPF SGLFSSSSSS SASASGSSHL GENS                        344
//

If you have problems or comments...

PBIL Back to PBIL home page