(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26410

AL161565.AT4G26410   Location/Qualifiers
FT   CDS             join(43938..44180,44673..44739,44956..45033,45269..45467,
FT                   45555..45619,45735..45793,45880..45969)
FT                   /gene="AT4g26410"
FT                   /product="putative protein"
FT                   /note="contains EST gb:T46533, AI999195.1, AA394459"
FT                   /db_xref="GOA:Q84K90"
FT                   /db_xref="InterPro:IPR016803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q84K90"
FT                   /protein_id="CAB79496.1"
FT                   /translation="MSETEATGVTDDSAPAIETETVSDAMEHTAIGVVESVEGAIEGAE
FT                   KWVGDLQRTVKESKDTAMRSARSLRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTD
FT                   ELIYAKEHPAAAIGIGVAASLVLMRVALVCVPSLIFTSTSKSSSLQAQFLKAEKHVQEL
FT                   NMSVDLMKKESRKLLERTALAEKDMKRGLSELMNSGNDIHRLAKSVHKAECEAADLMDG
FT                   LRQIPGRDAIKLRAEVASMTSLLRQKRIALNKRIMGMSDLGVSV"
     MSETEATGVT DDSAPAIETE TVSDAMEHTA IGVVESVEGA IEGAEKWVGD LQRTVKESKD        60
     TAMRSARSLR ENSTSQFRSI QDFIPHALTQ YKTYENAFFS KVTDELIYAK EHPAAAIGIG       120
     VAASLVLMRV ALVCVPSLIF TSTSKSSSLQ AQFLKAEKHV QELNMSVDLM KKESRKLLER       180
     TALAEKDMKR GLSELMNSGN DIHRLAKSVH KAECEAADLM DGLRQIPGRD AIKLRAEVAS       240
     MTSLLRQKRI ALNKRIMGMS DLGVSV                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page