(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26420

AL161565.AT4G26420   Location/Qualifiers
FT   CDS             complement(join(46316..46805,47197..47520,48157..48431,
FT                   48520..48807,49182..49664))
FT                   /gene="AT4g26420"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /note="contains EST gb:AI999195.1, AA394459"
FT                   /db_xref="GOA:F4JUY5"
FT                   /db_xref="InterPro:IPR005299"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042086"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4JUY5"
FT                   /protein_id="CAB79497.1"
FT                   /translation="MESSRSLEHVLSMQGGEDDASYVKNCYGPAARLALSKPMLTTAIN
FT                   SIKLTEGCSSHLKIADLGCAIGDNTFSTVETVVEVLGKKLAVIDGGTEPEMEFEVFFSD
FT                   LSSNDFNALFRSLDEKVNGSSRKYFAAGVPGSFYKRLFPKGELHVVVTMSALQWLSQVP
FT                   EKVMEKGSKSWNKGGVWIEGAEKEVVEAYAEQADKDLVEFLKCRKEEIVVGGVLFMLMG
FT                   GRPSGSVNQIGDPDSSLKHPFTTLMDQAWQDLVDEGLIEEEKRDGFNIPVYFRTTEEIA
FT                   AAIDRCGGFKIEKTENLIIADHMNGKQEELMKDPDSYGRDRANYAQAGLKPIVQAYLGP
FT                   DLTHKLFKRMRGRGPRSGFASSCGGDGSTLTLNQHQKNDVGPSVTPENTPFGGGSPRTL
FT                   EEMILQLEVEEDIVRRARLRESYYGTYDNCDDHNDVDDDKLYHQPARMSCVNSSDILRS
FT                   ARNALNQYPRFSLDGKDAMYRSSFRRHLGTSADMTIQGGRRSHCGDQRTSKRSSQMSLE
FT                   TKRLPRTVAGESVVWCKTGVVAKLMGLEMIPVPDKGKSGKDKLGTLLKRERLRRRERTL
FT                   DVNGRTGPTTEASCSSGGFNITRPIGAVGSPSRMGGWPTARLP"
     MESSRSLEHV LSMQGGEDDA SYVKNCYGPA ARLALSKPML TTAINSIKLT EGCSSHLKIA        60
     DLGCAIGDNT FSTVETVVEV LGKKLAVIDG GTEPEMEFEV FFSDLSSNDF NALFRSLDEK       120
     VNGSSRKYFA AGVPGSFYKR LFPKGELHVV VTMSALQWLS QVPEKVMEKG SKSWNKGGVW       180
     IEGAEKEVVE AYAEQADKDL VEFLKCRKEE IVVGGVLFML MGGRPSGSVN QIGDPDSSLK       240
     HPFTTLMDQA WQDLVDEGLI EEEKRDGFNI PVYFRTTEEI AAAIDRCGGF KIEKTENLII       300
     ADHMNGKQEE LMKDPDSYGR DRANYAQAGL KPIVQAYLGP DLTHKLFKRM RGRGPRSGFA       360
     SSCGGDGSTL TLNQHQKNDV GPSVTPENTP FGGGSPRTLE EMILQLEVEE DIVRRARLRE       420
     SYYGTYDNCD DHNDVDDDKL YHQPARMSCV NSSDILRSAR NALNQYPRFS LDGKDAMYRS       480
     SFRRHLGTSA DMTIQGGRRS HCGDQRTSKR SSQMSLETKR LPRTVAGESV VWCKTGVVAK       540
     LMGLEMIPVP DKGKSGKDKL GTLLKRERLR RRERTLDVNG RTGPTTEASC SSGGFNITRP       600
     IGAVGSPSRM GGWPTARLP                                                    619
//

If you have problems or comments...

PBIL Back to PBIL home page