(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26430

AL161565.AT4G26430   Location/Qualifiers
FT   CDS             join(52406..52703,52784..52872,52960..53053,53149..53210,
FT                   53301..53379,53754..53854,53984..54039,54422..54503)
FT                   /gene="AT4g26430"
FT                   /product="putative protein"
FT                   /note="similarity to hypothetical protein YOR261c, yeast,
FT                   PIR2:S67158"
FT                   /note="contains EST gb:T21187"
FT                   /db_xref="GOA:Q8W1P0"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR024969"
FT                   /db_xref="InterPro:IPR033859"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8W1P0"
FT                   /protein_id="CAB79498.1"
FT                   /translation="MAPSSSSGLTFKLHPLVMLNISDHFTRVKTQLNPPAASCATGNGS
FT                   NNADAMLLQNPRVYGCVIGLQRGRTVEIFNSFELIFDPALDTLDRSFLEKKQELYKKVF
FT                   PDFYVLGWYSTGSDATESDMHIHKALMDINESPVYVLLNPAINHAQKDLPVTIYESEFH
FT                   VIDGIPQSIFVHTSYTIETVEAERISVDHVAHLKPSDGGSAATQCDKPCENSVLRQVSS
FT                   LLRSLPAAESEKFNENFLMEYNDKLLMSYLAMITNCTSNMNEVVDKFNTAYDKHSRRGG
FT                   RTAFM"
     MAPSSSSGLT FKLHPLVMLN ISDHFTRVKT QLNPPAASCA TGNGSNNADA MLLQNPRVYG        60
     CVIGLQRGRT VEIFNSFELI FDPALDTLDR SFLEKKQELY KKVFPDFYVL GWYSTGSDAT       120
     ESDMHIHKAL MDINESPVYV LLNPAINHAQ KDLPVTIYES EFHVIDGIPQ SIFVHTSYTI       180
     ETVEAERISV DHVAHLKPSD GGSAATQCDK PCENSVLRQV SSLLRSLPAA ESEKFNENFL       240
     MEYNDKLLMS YLAMITNCTS NMNEVVDKFN TAYDKHSRRG GRTAFM                      286
//

If you have problems or comments...

PBIL Back to PBIL home page