(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26440

AL161565.AT4G26440   Location/Qualifiers
FT   CDS             complement(join(54773..55304,55381..55539,55627..56324,
FT                   56410..56727))
FT                   /gene="AT4g26440"
FT                   /product="putative protein"
FT                   /note="similarity to SPF1 protein, Ipomoea batatas,
FT                   PIR2:S51529"
FT                   /note="contains EST gb:N37131, AA585811, T44598,
FT                   AI995443.1, AI993164.1, T45479, F14100"
FT                   /db_xref="GOA:O65590"
FT                   /db_xref="InterPro:IPR003657"
FT                   /db_xref="InterPro:IPR036576"
FT                   /db_xref="UniProtKB/Swiss-Prot:O65590"
FT                   /protein_id="CAB79499.1"
FT                   /translation="MAGIDNKAAVMGEWFDCSTTNHRKRSKAELGREFSLNYIKNEDSL
FT                   QTTFQESSRGALRERIAARSGFNAPWLNTEDILQSKSLTISSPGLSPATLLESPVFLSN
FT                   PLLSPTTGKLSSVPSDKAKAELFDDITTSLAFQTISGSGLDPTNIALEPDDSQDYEERQ
FT                   LGGLGDSMACCAPADDGYNWRKYGQKLVKGSEYPRSYYKCTHPNCEAKKKVERSREGHI
FT                   IEIIYTGDHIHSKPPPNRRSGIGSSGTGQDMQIDATEYEGFAGTNENIEWTSPVSAELE
FT                   YGSHSGSMQVQNGTHQFGYGDAAADALYRDENEDDRTSHMSVSLTYDGEVEESESKRRK
FT                   LEAYATETSGSTRASREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRSYYKCTA
FT                   NGCTVTKHVERASDDFKSVLTTYIGKHTHVVPAARNSSHVGAGSSGTLQGSLATQTHNH
FT                   NVHYPMPHSRSEGLATANSSLFDFQSHLRHPTGFSVYIGQSELSDLSMPGLTIGQEKLT
FT                   SLQAPDIGDPTGLMLQLAAQPKVEPVSPQQGLDLSASSLICREMLSRLRQI"
     MAGIDNKAAV MGEWFDCSTT NHRKRSKAEL GREFSLNYIK NEDSLQTTFQ ESSRGALRER        60
     IAARSGFNAP WLNTEDILQS KSLTISSPGL SPATLLESPV FLSNPLLSPT TGKLSSVPSD       120
     KAKAELFDDI TTSLAFQTIS GSGLDPTNIA LEPDDSQDYE ERQLGGLGDS MACCAPADDG       180
     YNWRKYGQKL VKGSEYPRSY YKCTHPNCEA KKKVERSREG HIIEIIYTGD HIHSKPPPNR       240
     RSGIGSSGTG QDMQIDATEY EGFAGTNENI EWTSPVSAEL EYGSHSGSMQ VQNGTHQFGY       300
     GDAAADALYR DENEDDRTSH MSVSLTYDGE VEESESKRRK LEAYATETSG STRASREPRV       360
     VVQTTSDIDI LDDGYRWRKY GQKVVKGNPN PRSYYKCTAN GCTVTKHVER ASDDFKSVLT       420
     TYIGKHTHVV PAARNSSHVG AGSSGTLQGS LATQTHNHNV HYPMPHSRSE GLATANSSLF       480
     DFQSHLRHPT GFSVYIGQSE LSDLSMPGLT IGQEKLTSLQ APDIGDPTGL MLQLAAQPKV       540
     EPVSPQQGLD LSASSLICRE MLSRLRQI                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page