(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26450

AL161565.AT4G26450   Location/Qualifiers
FT   CDS             join(59733..61570,61651..61804,61862..61958,62897..63796,
FT                   63975..64454,64827..64914,65666..65855)
FT                   /gene="AT4g26450"
FT                   /product="putative protein"
FT                   /note="contains EST gb:N96063, T45506, AA395523"
FT                   /db_xref="GOA:Q8GXA4"
FT                   /db_xref="InterPro:IPR040276"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CB21"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8GXA4"
FT                   /protein_id="CAB79500.1"
FT                   /translation="MHARQRNVGNGYRSGSIGMGMSGSRISPERPMRGHGFYGSEHQHR
FT                   GFNRGYGRGRGRSKSYHNQLPPPLPPPPVQRRSSGGDVFMEAGRLATEYLVSQGVLPQT
FT                   VLSSKWQNGNFRKQAGEFQSSRSQEEARMDVSAPAAEKRRYIDGYSSAGSRNSLKGRRS
FT                   HRYDSDFGRSGSWSERSKAFETETGDDSVSGHQEEQPLAEDIASSVQRSASGEFMRKCE
FT                   GAGDSESVLDKYNLQDEAQSKTGSSSAGKDIVQDCEISKVSEGSSSLSAGSGEMKGRSG
FT                   GNGGEDENQTAIEDGSIHQRCEDASIDQQCGADESFTKSGIDLATLCKFEKVPTRTRSS
FT                   LTAKGPKLYLSHNIKDTSHNSGLEEEDQTENRCETRGQSSGKADSTGDENDQVEDFALV
FT                   QYIENSKCHRSNSFPSSILRDNSEKESGLELPNLHRSHSVGKVGEKRPGEGSDLEEGSK
FT                   RQRDWVAVSEANERFNMFKTSGNQCDPEEEGKTSSFNKRLIDGAAGKRVSHESLVNNST
FT                   YNRTHTGRTGPGYAEEHQLFPASFKMCDLNLGGASDVNDGIKESRQAVDFDLSISSSSK
FT                   SLEFGTSTRMSNGKEIEVINLDDDQEVVKSSNDPGRKQEAAPYMGIDDVPDYNERLMMV
FT                   EYLDSFTPINQGTSSVPQNNNTVSLQDREILKTSQGAIGNDQVPNNTDDDSIFMSLGEI
FT                   PLNFFVESMDLESESSALESVDDNVLIQQSASNVCDDGRSLDNGSCSDESVKLLSTSNS
FT                   VELGKPMSFDSPGDGGGAYSPVLKGQGLRKWRRIRRDLVKDTSANMENSKALKRGLSGV
FT                   AHSHGKQMQFQSPEVEQESQGSVGSVNMLKSSGDGFDILGSSGYDSRFVAGVGFSAGMD
FT                   LEIDDDRSSKSSTVARAPKVIRYEKPMISSGQGGNIRVENSKKHRGESVDFEKENSYSS
FT                   LESDSRKQSGRMMDYNGENGETSMRKDDAGGEGGESINTDNRYSDEMDPLTEAINGFLA
FT                   LQDALEKEVQQFQEIGNEPMPQHHEQVSEANSPHPEIVTLVNNVEQLENMLEETRSMLE
FT                   VKESHIRDLESTTNQSKHSWGGTEIVVEDIFRQKIEAEIEYLIYSRSIDNLNSQMKLID
FT                   EQESLAEEQTHETLNKLGRVQTKAANFTNRAQDLQNDCIEITGTIKKRAFNTNKAKTAV
FT                   AAEINSEIKRGVESAVEAFRKRRPIRNKLKMEGGEGRQQKDIPDMELEEERDTNSAIRK
FT                   KNNNISSMKLLLKKLVTFSKKNT"
     MHARQRNVGN GYRSGSIGMG MSGSRISPER PMRGHGFYGS EHQHRGFNRG YGRGRGRSKS        60
     YHNQLPPPLP PPPVQRRSSG GDVFMEAGRL ATEYLVSQGV LPQTVLSSKW QNGNFRKQAG       120
     EFQSSRSQEE ARMDVSAPAA EKRRYIDGYS SAGSRNSLKG RRSHRYDSDF GRSGSWSERS       180
     KAFETETGDD SVSGHQEEQP LAEDIASSVQ RSASGEFMRK CEGAGDSESV LDKYNLQDEA       240
     QSKTGSSSAG KDIVQDCEIS KVSEGSSSLS AGSGEMKGRS GGNGGEDENQ TAIEDGSIHQ       300
     RCEDASIDQQ CGADESFTKS GIDLATLCKF EKVPTRTRSS LTAKGPKLYL SHNIKDTSHN       360
     SGLEEEDQTE NRCETRGQSS GKADSTGDEN DQVEDFALVQ YIENSKCHRS NSFPSSILRD       420
     NSEKESGLEL PNLHRSHSVG KVGEKRPGEG SDLEEGSKRQ RDWVAVSEAN ERFNMFKTSG       480
     NQCDPEEEGK TSSFNKRLID GAAGKRVSHE SLVNNSTYNR THTGRTGPGY AEEHQLFPAS       540
     FKMCDLNLGG ASDVNDGIKE SRQAVDFDLS ISSSSKSLEF GTSTRMSNGK EIEVINLDDD       600
     QEVVKSSNDP GRKQEAAPYM GIDDVPDYNE RLMMVEYLDS FTPINQGTSS VPQNNNTVSL       660
     QDREILKTSQ GAIGNDQVPN NTDDDSIFMS LGEIPLNFFV ESMDLESESS ALESVDDNVL       720
     IQQSASNVCD DGRSLDNGSC SDESVKLLST SNSVELGKPM SFDSPGDGGG AYSPVLKGQG       780
     LRKWRRIRRD LVKDTSANME NSKALKRGLS GVAHSHGKQM QFQSPEVEQE SQGSVGSVNM       840
     LKSSGDGFDI LGSSGYDSRF VAGVGFSAGM DLEIDDDRSS KSSTVARAPK VIRYEKPMIS       900
     SGQGGNIRVE NSKKHRGESV DFEKENSYSS LESDSRKQSG RMMDYNGENG ETSMRKDDAG       960
     GEGGESINTD NRYSDEMDPL TEAINGFLAL QDALEKEVQQ FQEIGNEPMP QHHEQVSEAN      1020
     SPHPEIVTLV NNVEQLENML EETRSMLEVK ESHIRDLEST TNQSKHSWGG TEIVVEDIFR      1080
     QKIEAEIEYL IYSRSIDNLN SQMKLIDEQE SLAEEQTHET LNKLGRVQTK AANFTNRAQD      1140
     LQNDCIEITG TIKKRAFNTN KAKTAVAAEI NSEIKRGVES AVEAFRKRRP IRNKLKMEGG      1200
     EGRQQKDIPD MELEEERDTN SAIRKKNNNI SSMKLLLKKL VTFSKKNT                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page