(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26460

AL161565.AT4G26460   Location/Qualifiers
FT   CDS             join(66707..66928,67036..67188)
FT                   /gene="AT4g26460"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:O65588"
FT                   /db_xref="InterPro:IPR005299"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:O65588"
FT                   /protein_id="CAB79501.1"
FT                   /translation="MLIYALDFFIRFPRKDDSQIMELCIGTVNNGTSDKTADQIKATME
FT                   AAYRVLYRHAPLPRNIFGPMFPMSYLHVAVPEKVVENGWNKRKAWIEGSDRQVLMRYAE
FT                   QADKDLVDFLAEPCRGILMP"
     MLIYALDFFI RFPRKDDSQI MELCIGTVNN GTSDKTADQI KATMEAAYRV LYRHAPLPRN        60
     IFGPMFPMSY LHVAVPEKVV ENGWNKRKAW IEGSDRQVLM RYAEQADKDL VDFLAEPCRG       120
     ILMP                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page