(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26470

AL161565.AT4G26470   Location/Qualifiers
FT   CDS             join(68554..68752,68831..69033,69141..69309,69345..69520)
FT                   /gene="AT4g26470"
FT                   /product="putative protein"
FT                   /note="similarity to probable calcium-dependent protein
FT                   kinase, Oryza sativa, PIR2:S56652"
FT                   /note="Contains EF-hand calcium-binding domain
FT                   AA67-79;EF-hand calcium-binding domain AA158-170;EF-hand
FT                   calcium-binding domain AA211-223"
FT                   /note="contains EST gb:H77175"
FT                   /db_xref="GOA:Q52K82"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q52K82"
FT                   /protein_id="CAB79502.1"
FT                   /translation="MGGAVTKSETLQKEWVPETKLEAKIIEAVQRRASRGTTMKSFNSI
FT                   VLKFPKIDDGLRNCKAIFQEFDEDSNGSIDHTELKNCIRKLEISFDEEEINDLFKACDI
FT                   NEDMGITFTEFIVLLCLVYLLKDDSSTLQKKWTMGMPKLEPTFETLVDTFVFLDENKDG
FT                   YVSREEMVRAIDESGERSSGRIAMKRFAFFFTEPRILILIPVSAEEMDWDKNGMVNFKE
FT                   FLFAFTQWVGIDENEEEEEEDNNEKA"
     MGGAVTKSET LQKEWVPETK LEAKIIEAVQ RRASRGTTMK SFNSIVLKFP KIDDGLRNCK        60
     AIFQEFDEDS NGSIDHTELK NCIRKLEISF DEEEINDLFK ACDINEDMGI TFTEFIVLLC       120
     LVYLLKDDSS TLQKKWTMGM PKLEPTFETL VDTFVFLDEN KDGYVSREEM VRAIDESGER       180
     SSGRIAMKRF AFFFTEPRIL ILIPVSAEEM DWDKNGMVNF KEFLFAFTQW VGIDENEEEE       240
     EEDNNEKA                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page