(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26480

AL161565.AT4G26480   Location/Qualifiers
FT   CDS             complement(join(70062..70208,70301..70444,70527..70643,
FT                   70719..70832,71310..71449,72060..72145,72792..72999,
FT                   73356..73413,73911..74083,74897..75138,75229..75433,
FT                   75534..75567))
FT                   /gene="AT4g26480"
FT                   /product="putative protein"
FT                   /note="similarity to qkI-7, Mus musculus"
FT                   /note="contains EST gb:H76841, T21753, H36880"
FT                   /db_xref="GOA:Q0WLR1"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR019446"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032377"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C8L4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0WLR1"
FT                   /protein_id="CAB79503.1"
FT                   /translation="MNITATSLDSEDELSIKYMDAVDNINILKRYGCDIQHEVDVHTMS
FT                   FDNSLSLQRYDRIVFNFPHAGSRFFGRELSSRAIESHKELVRGFLENAKEMLEEDGEIH
FT                   ITHKTTYPFSDWGIKKLGKGEGLKLLKKSKFELSHYPGYITKRGSGGRRSDDYFPVDVD
FT                   PCDLKGFEVLEIYHPSMSDGFVNSVMVARKLTDRLIKYEWCTGTRSLNSLKKTRQTEPD
FT                   QFNKREINRSGPGQVAEEEEEVVAVMMMMTSLGGGAGGGGGGGGSGGGRFVTYPPPLSV
FT                   PPSAPQSPNFSGGLRSQPSFLVEQEKYLSELLAERHKLTPFLPVLPHVCRLMNQEILRV
FT                   TTLLENALSQSRFDHPSPLASGGIFQNSRADMNGWASQFPSERSVSSSPAPNWLNSPGS
FT                   SSGLIVKRTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDPI
FT                   KEDMMRGKPGYEHLNEPLHILVEAELPIEIVDARLMQAREILDDLLTPVEETHDFYKKQ
FT                   QLRELALLNGSLREEGSPMSGSISPYNSLGMKRAKTRG"
     MNITATSLDS EDELSIKYMD AVDNINILKR YGCDIQHEVD VHTMSFDNSL SLQRYDRIVF        60
     NFPHAGSRFF GRELSSRAIE SHKELVRGFL ENAKEMLEED GEIHITHKTT YPFSDWGIKK       120
     LGKGEGLKLL KKSKFELSHY PGYITKRGSG GRRSDDYFPV DVDPCDLKGF EVLEIYHPSM       180
     SDGFVNSVMV ARKLTDRLIK YEWCTGTRSL NSLKKTRQTE PDQFNKREIN RSGPGQVAEE       240
     EEEVVAVMMM MTSLGGGAGG GGGGGGSGGG RFVTYPPPLS VPPSAPQSPN FSGGLRSQPS       300
     FLVEQEKYLS ELLAERHKLT PFLPVLPHVC RLMNQEILRV TTLLENALSQ SRFDHPSPLA       360
     SGGIFQNSRA DMNGWASQFP SERSVSSSPA PNWLNSPGSS SGLIVKRTIR VDIPVDKYPN       420
     YNFVGRLLGP RGNSLKRVEA STDCRVLIRG RGSIKDPIKE DMMRGKPGYE HLNEPLHILV       480
     EAELPIEIVD ARLMQAREIL DDLLTPVEET HDFYKKQQLR ELALLNGSLR EEGSPMSGSI       540
     SPYNSLGMKR AKTRG                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page