(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26490

AL161565.AT4G26490   Location/Qualifiers
FT   CDS             join(77749..77872,77930..78408)
FT                   /gene="AT4g26490"
FT                   /product="hypothetical protein"
FT                   /note="contains EST gb:AI996141.1"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="UniProtKB/TrEMBL:O65585"
FT                   /protein_id="CAB79504.1"
FT                   /translation="MVLTKPATVRFNGLDAEPRKDRVILRQPRSSRTSLWIWCVAVFLA
FT                   IRPRIPVFDIPNANLHTIYFDTPEFFNGDLSMLVNFTNPNKKIEVKFEKLRIELFFFNR
FT                   LIAAQVVQPFLQKKHETRLEPIRLISSLVGLPVNHAVELRRQLENNKIEYEIRGTFKVK
FT                   AHFGMIHYSYQLHGRCQLQMTGPPTGILISRNCTTKK"
     MVLTKPATVR FNGLDAEPRK DRVILRQPRS SRTSLWIWCV AVFLAIRPRI PVFDIPNANL        60
     HTIYFDTPEF FNGDLSMLVN FTNPNKKIEV KFEKLRIELF FFNRLIAAQV VQPFLQKKHE       120
     TRLEPIRLIS SLVGLPVNHA VELRRQLENN KIEYEIRGTF KVKAHFGMIH YSYQLHGRCQ       180
     LQMTGPPTGI LISRNCTTKK                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page