(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26500

AL161565.AT4G26500   Location/Qualifiers
FT   CDS             complement(79633..80748)
FT                   /gene="AT4g26500"
FT                   /product="putative protein"
FT                   /note="similarity to Uvi31, Schizosaccharomyces pombe,
FT                   G1381578"
FT                   /db_xref="GOA:Q84W65"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="PDB:4PUI"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q84W65"
FT                   /protein_id="CAB79505.1"
FT                   /translation="MAAAMSSSCCASSLRLIPFKRTLFSSIHYPAKTLLLRPLKPSEVP
FT                   SFRRTIITFQKISTGIVPPPSASSSPSSYGDLQPIEELPPKLQEIVKLFQSVQEPKAKY
FT                   EQLMFYGKNLTPLDSQFKTRENKVEGCVSQVWVRAFFDEERNVVYEADSDSVLTKGLAA
FT                   LLVKGLSGRPVPEILRITPDFAVLLGLQQSLSPSRNNGLLNMLKLMQKKALHLEVKGEE
FT                   DSSSGESSESSFVSIPETKDEANVPEVDLESKPDLVEDLGTEKIDDSESGSNVVALGSR
FT                   GMRIREKLEKELDPVELEVEDVSYQHAGHAAVRGSAGDDGETHFNLRIVSDAFQGKSLV
FT                   KRHRLIYDLLQDELKSGLHALSIVAKTPAEV"
     MAAAMSSSCC ASSLRLIPFK RTLFSSIHYP AKTLLLRPLK PSEVPSFRRT IITFQKISTG        60
     IVPPPSASSS PSSYGDLQPI EELPPKLQEI VKLFQSVQEP KAKYEQLMFY GKNLTPLDSQ       120
     FKTRENKVEG CVSQVWVRAF FDEERNVVYE ADSDSVLTKG LAALLVKGLS GRPVPEILRI       180
     TPDFAVLLGL QQSLSPSRNN GLLNMLKLMQ KKALHLEVKG EEDSSSGESS ESSFVSIPET       240
     KDEANVPEVD LESKPDLVED LGTEKIDDSE SGSNVVALGS RGMRIREKLE KELDPVELEV       300
     EDVSYQHAGH AAVRGSAGDD GETHFNLRIV SDAFQGKSLV KRHRLIYDLL QDELKSGLHA       360
     LSIVAKTPAE V                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page