(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26520

AL161565.AT4G26520   Location/Qualifiers
FT   CDS             join(85852..85879,85960..86213,86346..86774,87002..87367)
FT                   /gene="AT4g26520"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /note="Contains Fructose-bisphosphate aldolase class-I
FT                   active site AA217-227"
FT                   /note="contains EST gb:AI994456.1"
FT                   /db_xref="GOA:P22197"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR029768"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22197"
FT                   /protein_id="CAB79507.1"
FT                   /translation="MSAFVSKYEDELIKTAKYIATPGRGILAADESTETIGKRFAGINV
FT                   ENTESNRQAYRELLFTSPGSYPCLSGVILFEETLYQKTSDGKPFVDLLMENGVIPGIKV
FT                   DKGLVDLAGTNGETTTQGLDSLGARCQQYYEAGARFAKWRAFFKIGATEPSVLSIQEDA
FT                   RVLARYAIICQENGLVPIVEPEVLTGGSHDIKKCAAVTETVLAAVFKALNYHHVLLEGT
FT                   LLKPNMVTPGSDSPKVAPELIAEYTVTALRRTVPPAIPGIVFLSGIQREEQATLNLNAM
FT                   NKLDVLKPWTLTFSFGGALQQSAIKAWAGKPENVAKAQAKFLTRCKANKDATLGKYTGW
FT                   ASGDSAAFENLVVIGYRY"
     MSAFVSKYED ELIKTAKYIA TPGRGILAAD ESTETIGKRF AGINVENTES NRQAYRELLF        60
     TSPGSYPCLS GVILFEETLY QKTSDGKPFV DLLMENGVIP GIKVDKGLVD LAGTNGETTT       120
     QGLDSLGARC QQYYEAGARF AKWRAFFKIG ATEPSVLSIQ EDARVLARYA IICQENGLVP       180
     IVEPEVLTGG SHDIKKCAAV TETVLAAVFK ALNYHHVLLE GTLLKPNMVT PGSDSPKVAP       240
     ELIAEYTVTA LRRTVPPAIP GIVFLSGIQR EEQATLNLNA MNKLDVLKPW TLTFSFGGAL       300
     QQSAIKAWAG KPENVAKAQA KFLTRCKANK DATLGKYTGW ASGDSAAFEN LVVIGYRY         358
//

If you have problems or comments...

PBIL Back to PBIL home page