(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26530

AL161565.AT4G26530   Location/Qualifiers
FT   CDS             join(88742..88769,88849..89102,89219..89647,89748..90113)
FT                   /gene="AT4g26530"
FT                   /product="fructose-bisphosphate aldolase-like protein"
FT                   /note="strong similarity to fructose-bisphosphate aldolase,
FT                   Arabidopsis thaliana, PIR1:ADMU"
FT                   /note="Contains Fructose-bisphosphate aldolase class-I
FT                   active site AA217-227"
FT                   /note="contains EST gb:AI994456.1, H36738, T44098,
FT                   AI099760"
FT                   /db_xref="GOA:O65581"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR029768"
FT                   /db_xref="UniProtKB/Swiss-Prot:O65581"
FT                   /protein_id="CAB79508.1"
FT                   /translation="MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRFASINV
FT                   ENIESNRQALRELLFTSPGTFPCLSGVILFEETLYQKTTDGKPFVELLMENGVIPGIKV
FT                   DKGVVDLAGTNGETTTQGLDSLGARCQEYYKAGARFAKWRAVLKIGATEPSELSIQENA
FT                   KGLARYAIICQENGLVPIVEPEVLTDGSHDIKKCAAVTETVLAAVYKALNDHHVLLEGT
FT                   LLKPNMVTPGSDSPKVAPEVIAEYTVTALRRTVPPAVPGIVFLSGGQSEEEATLNLNAM
FT                   NKLDVLKPWTLTFSFGRALQQSTLKAWAGKTENVAKAQATFLTRCKGNSDATLGKYTGG
FT                   ASGDSAASESLYEEGYKY"
     MSAFVGKYAD ELIKTAKYIA TPGKGILAAD ESTGTIGKRF ASINVENIES NRQALRELLF        60
     TSPGTFPCLS GVILFEETLY QKTTDGKPFV ELLMENGVIP GIKVDKGVVD LAGTNGETTT       120
     QGLDSLGARC QEYYKAGARF AKWRAVLKIG ATEPSELSIQ ENAKGLARYA IICQENGLVP       180
     IVEPEVLTDG SHDIKKCAAV TETVLAAVYK ALNDHHVLLE GTLLKPNMVT PGSDSPKVAP       240
     EVIAEYTVTA LRRTVPPAVP GIVFLSGGQS EEEATLNLNA MNKLDVLKPW TLTFSFGRAL       300
     QQSTLKAWAG KTENVAKAQA TFLTRCKGNS DATLGKYTGG ASGDSAASES LYEEGYKY         358
//

If you have problems or comments...

PBIL Back to PBIL home page