(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26540

AL161565.AT4G26540   Location/Qualifiers
FT   CDS             complement(join(91849..92353,92396..93697,93921..95203))
FT                   /gene="AT4g26540"
FT                   /product="receptor protein kinase-like protein"
FT                   /note="strong similarity to Cf-2.1, Solanum
FT                   pimpinellifolium"
FT                   /note="Contains Protein kinases signatures and profile
FT                   AA691-713;Protein kinases signatures and profile AA804-816"
FT                   /note="contains EST gb:N37940, AA395026, T41929"
FT                   /db_xref="GOA:C0LGR3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="PDB:5HYX"
FT                   /db_xref="PDB:5HZ0"
FT                   /db_xref="PDB:5HZ1"
FT                   /db_xref="PDB:5HZ3"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0LGR3"
FT                   /protein_id="CAB79509.1"
FT                   /translation="MPPNIYRLSFFSSLLCFFFIPCFSLDQQGQALLSWKSQLNISGDA
FT                   FSSWHVADTSPCNWVGVKCNRRGEVSEIQLKGMDLQGSLPVTSLRSLKSLTSLTLSSLN
FT                   LTGVIPKEIGDFTELELLDLSDNSLSGDIPVEIFRLKKLKTLSLNTNNLEGHIPMEIGN
FT                   LSGLVELMLFDNKLSGEIPRSIGELKNLQVLRAGGNKNLRGELPWEIGNCENLVMLGLA
FT                   ETSLSGKLPASIGNLKRVQTIAIYTSLLSGPIPDEIGYCTELQNLYLYQNSISGSIPTT
FT                   IGGLKKLQSLLLWQNNLVGKIPTELGNCPELWLIDFSENLLTGTIPRSFGKLENLQELQ
FT                   LSVNQISGTIPEELTNCTKLTHLEIDNNLITGEIPSLMSNLRSLTMFFAWQNKLTGNIP
FT                   QSLSQCRELQAIDLSYNSLSGSIPKEIFGLEFLDLHTNSLSGSLLGTTLPKSLKFIDFS
FT                   DNALSSTLPPGIGLLTELTKLNLAKNRLSGEIPREISTCRSLQLLNLGENDFSGEIPDE
FT                   LGQIPSLAISLNLSCNRFVGEIPSRFSDLKNLGVLDVSHNQLTGNLNVLTDLQNLVSLN
FT                   ISYNDFSGDLPNTPFFRRLPLSDLASNRGLYISNAISTRPDPTTRNSSVVRLTILILVV
FT                   VTAVLVLMAVYTLVRARAAGKQLLGEEIDSWEVTLYQKLDFSIDDIVKNLTSANVIGTG
FT                   SSGVVYRITIPSGESLAVKKMWSKEESGAFNSEIKTLGSIRHRNIVRLLGWCSNRNLKL
FT                   LFYDYLPNGSLSSRLHGAGKGGCVDWEARYDVVLGVAHALAYLHHDCLPTIIHGDVKAM
FT                   NVLLGPHFEPYLADFGLARTISGYPNTGIDLAKPTNRPPMAGSLWLHGSSFDFDLFCLL
FT                   GFTEHASMQRITEKSDVYSYGVVLLEVLTGKHPLDPDLPGGAHLVKWVRDHLAEKKDPS
FT                   RLLDPRLDGRTDSIMHEMLQTLAVAFLCVSNKANERPLMKDVVAMLTEIRHIDVGRSET
FT                   EKIKAGGCGSKEPQQFMSNEKIINSHGSSNCSFAFSDDSV"
     MPPNIYRLSF FSSLLCFFFI PCFSLDQQGQ ALLSWKSQLN ISGDAFSSWH VADTSPCNWV        60
     GVKCNRRGEV SEIQLKGMDL QGSLPVTSLR SLKSLTSLTL SSLNLTGVIP KEIGDFTELE       120
     LLDLSDNSLS GDIPVEIFRL KKLKTLSLNT NNLEGHIPME IGNLSGLVEL MLFDNKLSGE       180
     IPRSIGELKN LQVLRAGGNK NLRGELPWEI GNCENLVMLG LAETSLSGKL PASIGNLKRV       240
     QTIAIYTSLL SGPIPDEIGY CTELQNLYLY QNSISGSIPT TIGGLKKLQS LLLWQNNLVG       300
     KIPTELGNCP ELWLIDFSEN LLTGTIPRSF GKLENLQELQ LSVNQISGTI PEELTNCTKL       360
     THLEIDNNLI TGEIPSLMSN LRSLTMFFAW QNKLTGNIPQ SLSQCRELQA IDLSYNSLSG       420
     SIPKEIFGLE FLDLHTNSLS GSLLGTTLPK SLKFIDFSDN ALSSTLPPGI GLLTELTKLN       480
     LAKNRLSGEI PREISTCRSL QLLNLGENDF SGEIPDELGQ IPSLAISLNL SCNRFVGEIP       540
     SRFSDLKNLG VLDVSHNQLT GNLNVLTDLQ NLVSLNISYN DFSGDLPNTP FFRRLPLSDL       600
     ASNRGLYISN AISTRPDPTT RNSSVVRLTI LILVVVTAVL VLMAVYTLVR ARAAGKQLLG       660
     EEIDSWEVTL YQKLDFSIDD IVKNLTSANV IGTGSSGVVY RITIPSGESL AVKKMWSKEE       720
     SGAFNSEIKT LGSIRHRNIV RLLGWCSNRN LKLLFYDYLP NGSLSSRLHG AGKGGCVDWE       780
     ARYDVVLGVA HALAYLHHDC LPTIIHGDVK AMNVLLGPHF EPYLADFGLA RTISGYPNTG       840
     IDLAKPTNRP PMAGSLWLHG SSFDFDLFCL LGFTEHASMQ RITEKSDVYS YGVVLLEVLT       900
     GKHPLDPDLP GGAHLVKWVR DHLAEKKDPS RLLDPRLDGR TDSIMHEMLQ TLAVAFLCVS       960
     NKANERPLMK DVVAMLTEIR HIDVGRSETE KIKAGGCGSK EPQQFMSNEK IINSHGSSNC      1020
     SFAFSDDSV                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page