(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26550

AL161565.AT4G26550   Location/Qualifiers
FT   CDS             complement(join(99930..100040,100413..100517,
FT                   100562..100964,101190..101489,103019..103201,
FT                   103298..103353))
FT                   /gene="AT4g26550"
FT                   /product="putative protein"
FT                   /note="EST DBES:T21637 matches to coord. (3049-3110,
FT                   3207-3389, 3910-3977), EST DBES:AA395643 matches to coord.
FT                   (4367-4444, 4534-4789)"
FT                   /note="similarity to probable membrane protein YBL102w,
FT                   yeast, PIR2:S45393"
FT                   /note="contains EST gb:AI994236.1, T21637"
FT                   /db_xref="GOA:Q944B0"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q944B0"
FT                   /protein_id="CAB79510.1"
FT                   /translation="MAMAMEISLPFVGSSMALSAGKSRNSVSRISRVGFSSVSAVHVPR
FT                   RMFMQLSGFGSVLTLLDFPSLAAPVPQMKEPEVISCGVYQKTLKRQRKISDRRRSGLSL
FT                   FAFLEDPETQKMSQGWFSMGGSSTVDQQQQSGSSLLADWNSYAASRDFEESGGSFGFDI
FT                   ESAVRSANDTVSGTFSVCFQESSFVSLIKFLFFCCFCNVPEFDDYRVSKGVRDIPGSLQ
FT                   SATSSMPSGKALMYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSF
FT                   FALRGPKNQLAHMSSMEVCYTVLLCVCHALNPRRLPSTLGFIATMVGTIYVSMVLHSYI
FT                   LSVLFSVLQVLALVYYCISYFPGGSSGMRFLSSALTSSALRVFGR"
     MAMAMEISLP FVGSSMALSA GKSRNSVSRI SRVGFSSVSA VHVPRRMFMQ LSGFGSVLTL        60
     LDFPSLAAPV PQMKEPEVIS CGVYQKTLKR QRKISDRRRS GLSLFAFLED PETQKMSQGW       120
     FSMGGSSTVD QQQQSGSSLL ADWNSYAASR DFEESGGSFG FDIESAVRSA NDTVSGTFSV       180
     CFQESSFVSL IKFLFFCCFC NVPEFDDYRV SKGVRDIPGS LQSATSSMPS GKALMYFGLL       240
     LASGVFFIFI AFTMFLPVMV LMPQKFAICF TLGCGFIIGS FFALRGPKNQ LAHMSSMEVC       300
     YTVLLCVCHA LNPRRLPSTL GFIATMVGTI YVSMVLHSYI LSVLFSVLQV LALVYYCISY       360
     FPGGSSGMRF LSSALTSSAL RVFGR                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page