(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26560

AL161565.AT4G26560   Location/Qualifiers
FT   CDS             complement(join(103908..103965,104069..104181,
FT                   104296..104429,104553..104661,104737..104796,
FT                   104908..104955,105026..105148))
FT                   /gene="AT4g26560"
FT                   /product="putative calcineurin B-like protein"
FT                   /note="strong similarity to calcineurin B-like protein 3
FT                   -Arabidopsis thaliana, PID:g3309086"
FT                   /note="Contains EF-hand calcium-binding domain AA83-95"
FT                   /note="contains EST gb:AI999389.1"
FT                   /db_xref="GOA:Q9SUA6"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SUA6"
FT                   /protein_id="CAB79511.1"
FT                   /translation="MDSTRNSASSNSTGCFTDQKKRKALYEVFKKLSGVDCQRNEGNVV
FT                   EGVTCYYGEMNKEQFHVAIFQTDKNESLFSERVFDLFDTNHDGLLGFEEFARALSVFHP
FT                   SAPIDDKIDLSFQLYDLKQQGFIERQGVKQLVVATLAASGMSQSDEIVESIIDKTFVQA
FT                   DTKHEGMIDEEEWMDLVFRHPLLLKNMTLQYLKDITTTFPSFVLHSQVEDT"
     MDSTRNSASS NSTGCFTDQK KRKALYEVFK KLSGVDCQRN EGNVVEGVTC YYGEMNKEQF        60
     HVAIFQTDKN ESLFSERVFD LFDTNHDGLL GFEEFARALS VFHPSAPIDD KIDLSFQLYD       120
     LKQQGFIERQ GVKQLVVATL AASGMSQSDE IVESIIDKTF VQADTKHEGM IDEEEWMDLV       180
     FRHPLLLKNM TLQYLKDITT TFPSFVLHSQ VEDT                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page