(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26570

AL161565.AT4G26570   Location/Qualifiers
FT   CDS             complement(join(105783..105840,105938..106050,
FT                   106168..106301,106422..106530,106617..106676,
FT                   106802..106884,107050..107173))
FT                   /gene="AT4g26570"
FT                   /product="calcineurin B-like protein 3"
FT                   /note="contains EST gb:AI999389.1, T21746"
FT                   /db_xref="GOA:Q8LEM7"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LEM7"
FT                   /protein_id="CAB79512.1"
FT                   /translation="MSQCIDGFKHVCSSFFRCFDIDIYKQSGGLGDPELLARETVFSVS
FT                   EIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGF
FT                   EEFARALSVFHPNAPIEDKIDFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLSDEI
FT                   IESIIDKTFEEADTKHDGRIDKEEWRTLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQ
FT                   VEDT"
     MSQCIDGFKH VCSSFFRCFD IDIYKQSGGL GDPELLARET VFSVSEIEAL YELFKKISSA        60
     VIDDGLINKE EFQLALFKTN KKESLFADRV FDLFDTKHNG ILGFEEFARA LSVFHPNAPI       120
     EDKIDFSFQL YDLKQQGFIE RQEVKQMVVA TLAESGMNLS DEIIESIIDK TFEEADTKHD       180
     GRIDKEEWRT LVLRHPSLLK NMTLQYLKDI TTTFPSFVFH SQVEDT                      226
//

If you have problems or comments...

PBIL Back to PBIL home page