(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26580

AL161565.AT4G26580   Location/Qualifiers
FT   CDS             complement(join(108880..109026,109117..109474,
FT                   109562..110133,110177..110242,110471..110609,
FT                   110734..110846))
FT                   /gene="AT4g26580"
FT                   /product="putative protein"
FT                   /note="similarity to RING zinc finger protein - Gallus
FT                   gallus (chicken), PID:e223435"
FT                   /note="contains EST gb:T88029"
FT                   /db_xref="GOA:Q9SUA5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SUA5"
FT                   /protein_id="CAB79513.1"
FT                   /translation="MEDKLDVLIMGELKLELVELRHYFPSSPLFDSITKLSEGREGERE
FT                   ERWRCLTKKKTRIDKAAAVAVGVLLRRQKTKVVRFYRPTSEDKVFDENASLIYPSMSFF
FT                   LHLKLYSVSLCSCSGDQIKDLSVSDMSTRYSSQLQSSAINSITVSSSSSFASTQLDDNT
FT                   HTAPESSPSSSFFMRLAMRVSRARWFIFLRRVFHYQNASRSDLGTNPFNSIAWMVSELI
FT                   ALLLQITVITSTLALSKNERPVWPMRLWITGYNVGCLLNLMLLYGRYRQQDTSHENAFS
FT                   FGDIEQQQRSREETTRCSHLMNKCRTSLELFFAIWFVIGNVWVFDSRFGSFHYAPILHV
FT                   LCISLLAWNALCYSFPFLLFLLLCCVVPLVSSFLGYNMNVGSSEKGASDDQISSLPSWK
FT                   YKLIDETSDSSQANNDPECCICLAKYKEKEEVRKLPCSHRFHLKCVDQWLRIISCCPLC
FT                   KQDLPN"
     MEDKLDVLIM GELKLELVEL RHYFPSSPLF DSITKLSEGR EGEREERWRC LTKKKTRIDK        60
     AAAVAVGVLL RRQKTKVVRF YRPTSEDKVF DENASLIYPS MSFFLHLKLY SVSLCSCSGD       120
     QIKDLSVSDM STRYSSQLQS SAINSITVSS SSSFASTQLD DNTHTAPESS PSSSFFMRLA       180
     MRVSRARWFI FLRRVFHYQN ASRSDLGTNP FNSIAWMVSE LIALLLQITV ITSTLALSKN       240
     ERPVWPMRLW ITGYNVGCLL NLMLLYGRYR QQDTSHENAF SFGDIEQQQR SREETTRCSH       300
     LMNKCRTSLE LFFAIWFVIG NVWVFDSRFG SFHYAPILHV LCISLLAWNA LCYSFPFLLF       360
     LLLCCVVPLV SSFLGYNMNV GSSEKGASDD QISSLPSWKY KLIDETSDSS QANNDPECCI       420
     CLAKYKEKEE VRKLPCSHRF HLKCVDQWLR IISCCPLCKQ DLPN                        464
//

If you have problems or comments...

PBIL Back to PBIL home page