(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26590

AL161565.AT4G26590   Location/Qualifiers
FT   CDS             complement(join(111309..112380,112500..113072,
FT                   113142..113239,113322..113773,113959..114025))
FT                   /gene="AT4g26590"
FT                   /product="isp4 like protein"
FT                   /note="strong similarity to isp4 protein
FT                   -Schizosaccharomyces pombe, PIR2:S45495"
FT                   /note="Contains Prenyl group binding site (CAAX box)
FT                   AA750-753;Prokaryotic membrane lipoprotein lipid attachment
FT                   site AA439-449;Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA457-467"
FT                   /note="contains EST gb:AI995580.1"
FT                   /db_xref="GOA:Q9SUA4"
FT                   /db_xref="InterPro:IPR004648"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SUA4"
FT                   /protein_id="CAB79514.1"
FT                   /translation="MVGSLEVSKPPEHKVESKIVIADEEEEDENDSPIEEVRLTVPITD
FT                   DPSLPVLTFRTWFLGMVSCVVLAFVNNFFGYRSNPLTVSSVVAQIITLPLGKLMATTLP
FT                   TTKLRLPGTNWSCSLNPGPFNMKEHVLITIFANTGAGGAYATSILTIVKAFYHRNLNPA
FT                   AAMLLVQTTQLLGYGWAGMFRKYLVDSPYMWWPANLVQVSLFRALHEKEEKREGKQTKL
FT                   RFFLIVFFLSFTYYIVPGYLFPSISYLSFVCWIWTRSVTAQQIGSGLHGLGIGSFGLDW
FT                   STVAGFLGSPLAVPFFAIANSFGGFIIFFYIILPIFYWSNAYEAKKFPFYTSHPFDHTG
FT                   QRYNTTRILNQKTFNIDLPAYESYSKLYLSILFALIYGLSFGTLTATISHVALFDGKFI
FT                   WELWKKATLTTKDKFGDVHTRLMKKNYKEVPQWWFVAVLAASFVLALYACEGFGKQLQL
FT                   PWWGLLLACAIAFTFTLPIGVILATTNQRMGLNVISELIIGFLYPGKPLANVAFKTYGS
FT                   VSIAQALYFVGDFKLGHYMKIPPRSMFIVQLVATIVASTVSFGTTWWLLSSVENICNTD
FT                   MLPKSSPWTCPGDVVFYNASIIWGIIGPGRMFTSKGIYPGMNWFFLIGFLAPVPVWFFA
FT                   RKFPEKKWIHQIHIPLIFSGANVMPMAKAVHYWSWFAVGIVFNYYIFRRYKGWWARHNY
FT                   ILSAALDAGTAVMGVLIYFALQNNNISLPDWWGNENTDHCPLANCPTEKGIVAKGCPVF
FT                   "
     MVGSLEVSKP PEHKVESKIV IADEEEEDEN DSPIEEVRLT VPITDDPSLP VLTFRTWFLG        60
     MVSCVVLAFV NNFFGYRSNP LTVSSVVAQI ITLPLGKLMA TTLPTTKLRL PGTNWSCSLN       120
     PGPFNMKEHV LITIFANTGA GGAYATSILT IVKAFYHRNL NPAAAMLLVQ TTQLLGYGWA       180
     GMFRKYLVDS PYMWWPANLV QVSLFRALHE KEEKREGKQT KLRFFLIVFF LSFTYYIVPG       240
     YLFPSISYLS FVCWIWTRSV TAQQIGSGLH GLGIGSFGLD WSTVAGFLGS PLAVPFFAIA       300
     NSFGGFIIFF YIILPIFYWS NAYEAKKFPF YTSHPFDHTG QRYNTTRILN QKTFNIDLPA       360
     YESYSKLYLS ILFALIYGLS FGTLTATISH VALFDGKFIW ELWKKATLTT KDKFGDVHTR       420
     LMKKNYKEVP QWWFVAVLAA SFVLALYACE GFGKQLQLPW WGLLLACAIA FTFTLPIGVI       480
     LATTNQRMGL NVISELIIGF LYPGKPLANV AFKTYGSVSI AQALYFVGDF KLGHYMKIPP       540
     RSMFIVQLVA TIVASTVSFG TTWWLLSSVE NICNTDMLPK SSPWTCPGDV VFYNASIIWG       600
     IIGPGRMFTS KGIYPGMNWF FLIGFLAPVP VWFFARKFPE KKWIHQIHIP LIFSGANVMP       660
     MAKAVHYWSW FAVGIVFNYY IFRRYKGWWA RHNYILSAAL DAGTAVMGVL IYFALQNNNI       720
     SLPDWWGNEN TDHCPLANCP TEKGIVAKGC PVF                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page