(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26600

AL161565.AT4G26600   Location/Qualifiers
FT   CDS             join(116804..117343,117440..117503,117633..117772,
FT                   117875..117958,118050..118124,118214..118285,
FT                   118379..118452,118698..118750,118833..118942,
FT                   119300..119374,119545..119637,119731..119810,
FT                   119898..119988,120103..120432)
FT                   /gene="AT4g26600"
FT                   /product="putative protein"
FT                   /note="similarity to proliferating-cell nucleolar antigen
FT                   P120 -Homo sapiens, PIR2:A48168"
FT                   /note="Contains ATP/GTP-binding site motif A (P-loop)
FT                   AA350-357"
FT                   /note="contains EST gb:T21343"
FT                   /db_xref="GOA:Q9LDL2"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023273"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LDL2"
FT                   /protein_id="CAB79515.1"
FT                   /translation="MAALTRNKKKGSNSQTPPLNKQTKASPLKKAAKTQKPPLKKQRKC
FT                   ISEKKPLKKPEVSTDEEEEEEENEQSDEGSESGSDLFSDGDEEGNNDSDDDDDDDDDDD
FT                   DDDEDAEPLAEDFLDGSDNEEVTMGSDLDSDSGGSKLERKSRAIDRKRKKEVQDADDEF
FT                   KMNIKEKPDEFQLPTQKELEEEARRPPDLPSLQMRIREIVRILSNFKDLKPKGDKHERN
FT                   DYVGQLKADLSSYYGYNEFLIGTLIEMFPVVELMELIEAFEKKRPTSIRTNTLKTRRRD
FT                   LADILLNRGVNLDPLSKWSKVGLIVYDSQVPIGATPEYLAGFYMLQSASSFLPVMALAP
FT                   REKERVVDMAAAPGGKTTYVAALMKNTGIIYANEMKVPRLKSLSANLHRMGVTNTIVCN
FT                   YDGREVISKDESVKTSKSADDIKKFAHLQKQLILGAIDLVDANSKTGGYIVYSTCSVMI
FT                   PENEAVIDYALKNRDVKLVPCGLDFGRPGFREHRFHPSLEKTRRFYPHVHNMDGFFVAK
FT                   LKKMSNAMQPSGNDEPAVTMEQAQVSSSDDDDEKAEAIEELEKPPVASGQPKRESNTKE
FT                   DTNKRKNPRSKEIHKGKRNKNTKTESGNVEEPRKQKKKRSQWKNEIAQAR"
     MAALTRNKKK GSNSQTPPLN KQTKASPLKK AAKTQKPPLK KQRKCISEKK PLKKPEVSTD        60
     EEEEEEENEQ SDEGSESGSD LFSDGDEEGN NDSDDDDDDD DDDDDDDEDA EPLAEDFLDG       120
     SDNEEVTMGS DLDSDSGGSK LERKSRAIDR KRKKEVQDAD DEFKMNIKEK PDEFQLPTQK       180
     ELEEEARRPP DLPSLQMRIR EIVRILSNFK DLKPKGDKHE RNDYVGQLKA DLSSYYGYNE       240
     FLIGTLIEMF PVVELMELIE AFEKKRPTSI RTNTLKTRRR DLADILLNRG VNLDPLSKWS       300
     KVGLIVYDSQ VPIGATPEYL AGFYMLQSAS SFLPVMALAP REKERVVDMA AAPGGKTTYV       360
     AALMKNTGII YANEMKVPRL KSLSANLHRM GVTNTIVCNY DGREVISKDE SVKTSKSADD       420
     IKKFAHLQKQ LILGAIDLVD ANSKTGGYIV YSTCSVMIPE NEAVIDYALK NRDVKLVPCG       480
     LDFGRPGFRE HRFHPSLEKT RRFYPHVHNM DGFFVAKLKK MSNAMQPSGN DEPAVTMEQA       540
     QVSSSDDDDE KAEAIEELEK PPVASGQPKR ESNTKEDTNK RKNPRSKEIH KGKRNKNTKT       600
     ESGNVEEPRK QKKKRSQWKN EIAQAR                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page