(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26610

AL161565.AT4G26610   Location/Qualifiers
FT   CDS             join(122743..123419,123520..124363)
FT                   /gene="AT4g26610"
FT                   /product="putative protein kinase"
FT                   /note="strong similarity to protein kinase -Arabidopsis
FT                   thaliana, PIR2:JN0505"
FT                   /note="Contains Protein kinases signatures and profile
FT                   AA244-256"
FT                   /note="contains EST gb:AI996119.1, AA042649, H36204,
FT                   AA041115"
FT                   /db_xref="GOA:Q9SUA3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SUA3"
FT                   /protein_id="CAB79516.1"
FT                   /translation="MASKYGSGVLPENKKEKGDKETPETSYSSQSVSVNTLADQVSSTL
FT                   SFAPSSDSKTGGEVKFNEKSDQSGKSNTCRPSTSSDISDESTCSSFSGNNKPHKANDVR
FT                   WEAIQAVRTKHGVLGLNHFRLLKRLGCGDIGTVHLAELHGTRCFFAMKVMDKGALASRK
FT                   KLLRAQTEREILQCLDHPFLPTLYSHFETEKFSCLVMEFCPGGDLHTLRQRQPGKRFSE
FT                   QAAKFYVAEVLLAMEYLHMLGIIYRDLKPENVLVRDDGHVMLSDFDLSLRCTVSPTVVR
FT                   STVLASEGQKNSGYCAQPACIQQPSCISAPTTCFSPRYFSSKSKKDKKMKNETGNQVSP
FT                   LPELVAEPTSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGS
FT                   GNRATLFNVVGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEMKQHPFFEG
FT                   VNWALVRCASPPEIPKPVDYESAPATPAAATSTSVKSDQSNYLEFDFF"
     MASKYGSGVL PENKKEKGDK ETPETSYSSQ SVSVNTLADQ VSSTLSFAPS SDSKTGGEVK        60
     FNEKSDQSGK SNTCRPSTSS DISDESTCSS FSGNNKPHKA NDVRWEAIQA VRTKHGVLGL       120
     NHFRLLKRLG CGDIGTVHLA ELHGTRCFFA MKVMDKGALA SRKKLLRAQT EREILQCLDH       180
     PFLPTLYSHF ETEKFSCLVM EFCPGGDLHT LRQRQPGKRF SEQAAKFYVA EVLLAMEYLH       240
     MLGIIYRDLK PENVLVRDDG HVMLSDFDLS LRCTVSPTVV RSTVLASEGQ KNSGYCAQPA       300
     CIQQPSCISA PTTCFSPRYF SSKSKKDKKM KNETGNQVSP LPELVAEPTS ARSMSFVGTH       360
     EYLAPEIIKG EGHGSAVDWW TFGIFLYELL FGKTPFKGSG NRATLFNVVG QPLRFPESPV       420
     VSFAARDLIR SLLVKEPQHR LAYKRGATEM KQHPFFEGVN WALVRCASPP EIPKPVDYES       480
     APATPAAATS TSVKSDQSNY LEFDFF                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page