(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26620

AL161565.AT4G26620   Location/Qualifiers
FT   CDS             complement(join(124774..125106,125155..125384,
FT                   125783..125985,126093..126178,126675..127052))
FT                   /gene="AT4g26620"
FT                   /product="sucrase-like protein"
FT                   /note="similarity to sucrose cleavage protein - potato,
FT                   Pir2:S51376"
FT                   /note="contains EST gb:F14262"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SUA2"
FT                   /protein_id="CAB79517.1"
FT                   /translation="MGSGRDRDDPLSFTSNPSTASSPVTVSDYLDNFLGEPTSRSGSFQ
FT                   SESLLGGGGGESINDADFGFARPDFRSEQLAGTVQFYERHVFLCYKKPSVWPARIEAAE
FT                   FDRLPRLLSAAVSARKGSMKKETRLTICEGHDGTETSNGDVLIFPDMIRYRRLTHFDVE
FT                   TFVEEVLVKDGEWLPGNPELLKGSYVFVCSHGSRDRRCGVCGPSLVSRFREELEFHGLQ
FT                   AHQQRRDCRPAMEVRTKFSCSVSFLAVSGLVVIGRFTHDASLIIRGEMGLSEEDQKKTQ
FT                   EGRFQLNGTVHSVKINGKSRAAEPNGCCQQNGNSSSCCQDDTTLMLSLGTSEDNQLESE
FT                   NNTEKLTPGRKIAEKTFFRINSDKGSSTRKVCGIPTWLESWEREDTYAALAVVCAAASV
FT                   AVAYTCYKQL"
     MGSGRDRDDP LSFTSNPSTA SSPVTVSDYL DNFLGEPTSR SGSFQSESLL GGGGGESIND        60
     ADFGFARPDF RSEQLAGTVQ FYERHVFLCY KKPSVWPARI EAAEFDRLPR LLSAAVSARK       120
     GSMKKETRLT ICEGHDGTET SNGDVLIFPD MIRYRRLTHF DVETFVEEVL VKDGEWLPGN       180
     PELLKGSYVF VCSHGSRDRR CGVCGPSLVS RFREELEFHG LQAHQQRRDC RPAMEVRTKF       240
     SCSVSFLAVS GLVVIGRFTH DASLIIRGEM GLSEEDQKKT QEGRFQLNGT VHSVKINGKS       300
     RAAEPNGCCQ QNGNSSSCCQ DDTTLMLSLG TSEDNQLESE NNTEKLTPGR KIAEKTFFRI       360
     NSDKGSSTRK VCGIPTWLES WEREDTYAAL AVVCAAASVA VAYTCYKQL                   409
//

If you have problems or comments...

PBIL Back to PBIL home page