(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26630

AL161565.AT4G26630   Location/Qualifiers
FT   CDS             complement(join(128048..128217,128305..128335,
FT                   128556..128647,128844..129342,129517..129600,
FT                   129683..129775,129975..130085,130165..130224,
FT                   130395..130477,130909..130942,131018..132052))
FT                   /gene="AT4g26630"
FT                   /product="putative protein"
FT                   /note="similarity to various Caenorhabditis elegans
FT                   predicted proteins"
FT                   /note="contains EST gb:AI996874.1, AI994758.1, H76680,
FT                   N38510, W43030, Z18476, AI996256.1"
FT                   /db_xref="GOA:Q9SUA1"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SUA1"
FT                   /protein_id="CAB79518.1"
FT                   /translation="MGEDTKATIEPTANKTTSLEKPSEAMAGKENAGGKETQELAKDED
FT                   MAEPDNMEIDAQIKKDDEKAETEDKESEVKKNEDNAETQKMEEKVEVTKDEGQAEATNM
FT                   DEDADGKKEQTDDGVSVEDTVMKENVESKDNNYAKDDEKETKETDITEADHKKAGKEDI
FT                   QHEADKANGTKDGNTGDIKEEGTLVDEDKGTDMDEKVENGDENKQVENVEGKEKEDKEE
FT                   NKTKEVEAAKAEVDESKVEDEKEGSEDENDNEKVESKDAKEDEKEETNDDKEDEKEESK
FT                   GSKKRGKGTSSGGKVREKNKTEEVKKDAEPRTPFSDRPVRERKSVERLVALIDKDSSKE
FT                   FRVEKGRGAYLKDIPNVANKVMRKRSDETLKLLHPILFGGRRGKAAQIKTNILGFSGFV
FT                   WHGDEKKAKEKVKEKLEKCTKEKLWEFCDVLDIHITKATTKKEDIITKLFEFLEKPHVT
FT                   GDVTGDTTVSEKEKSSKGAKRKRTPKKTSPTAGSSSSKRSAKSQKKSEEATKVVKKSLA
FT                   HSDDESEEEKEEEEKQEEEKAEEKEEKKEEENENGIPDKSEDEAPQPSESEEKDESEEH
FT                   SEEETTKKKRGSRLSAGKKESAGRARNKKAVVAAKSSPPEKITQKRSSAKRKKTDDDSD
FT                   TSPKASSKRKKSENPIKASPAPSKSASKEKPVKRAGKGKDKPSDKVLKNAIVEILKRVD
FT                   FSTATFTDILKELAKEFTEDLTPRKSSIKMIIQEELTKLADEEEEEEKKEEDSEKEEAG
FT                   GSGGGEEVKA"
     MGEDTKATIE PTANKTTSLE KPSEAMAGKE NAGGKETQEL AKDEDMAEPD NMEIDAQIKK        60
     DDEKAETEDK ESEVKKNEDN AETQKMEEKV EVTKDEGQAE ATNMDEDADG KKEQTDDGVS       120
     VEDTVMKENV ESKDNNYAKD DEKETKETDI TEADHKKAGK EDIQHEADKA NGTKDGNTGD       180
     IKEEGTLVDE DKGTDMDEKV ENGDENKQVE NVEGKEKEDK EENKTKEVEA AKAEVDESKV       240
     EDEKEGSEDE NDNEKVESKD AKEDEKEETN DDKEDEKEES KGSKKRGKGT SSGGKVREKN       300
     KTEEVKKDAE PRTPFSDRPV RERKSVERLV ALIDKDSSKE FRVEKGRGAY LKDIPNVANK       360
     VMRKRSDETL KLLHPILFGG RRGKAAQIKT NILGFSGFVW HGDEKKAKEK VKEKLEKCTK       420
     EKLWEFCDVL DIHITKATTK KEDIITKLFE FLEKPHVTGD VTGDTTVSEK EKSSKGAKRK       480
     RTPKKTSPTA GSSSSKRSAK SQKKSEEATK VVKKSLAHSD DESEEEKEEE EKQEEEKAEE       540
     KEEKKEEENE NGIPDKSEDE APQPSESEEK DESEEHSEEE TTKKKRGSRL SAGKKESAGR       600
     ARNKKAVVAA KSSPPEKITQ KRSSAKRKKT DDDSDTSPKA SSKRKKSENP IKASPAPSKS       660
     ASKEKPVKRA GKGKDKPSDK VLKNAIVEIL KRVDFSTATF TDILKELAKE FTEDLTPRKS       720
     SIKMIIQEEL TKLADEEEEE EKKEEDSEKE EAGGSGGGEE VKA                         763
//

If you have problems or comments...

PBIL Back to PBIL home page