(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26640

AL161565.AT4G26640   Location/Qualifiers
FT   CDS             complement(join(134473..134944,135209..135364,
FT                   135449..135605,135696..136200,136493..136648,
FT                   136725..136766,137641..137868))
FT                   /gene="AT4g26640"
FT                   /product="putative protein"
FT                   /note="similarity to SPF1 protein -Ipomoea batatas,
FT                   PIR2:S51529"
FT                   /note="contains EST gb:AA585811, AI995443.1, N37131,
FT                   T44598, AI993164.1, F14100, T45479, W43265"
FT                   /db_xref="GOA:Q93WV0"
FT                   /db_xref="InterPro:IPR003657"
FT                   /db_xref="InterPro:IPR036576"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q93WV0"
FT                   /protein_id="CAB79519.1"
FT                   /translation="MNPQANDRKEFQGDCSATGDLTAKHDSAGGNGGGGARYKLMSPAK
FT                   LPISRSTDITIPPGLSPTSFLESPVFISNIKKTVFFKTSCLLIDQPEPSPTTGSLFKPR
FT                   PVHISASSSSYTGRGFHQNTFTEQKSSEFEFRPPASNMVYAELGKIRSEPPVHFQGQGH
FT                   GSSHSPSSISDAAGSSSELSRPTPPCQMTPTSSDIPAGSDQEESIQTSQNDSRGSTPSI
FT                   LADDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSHDGQITDIIYKGTHDHP
FT                   KPQPGRRNSGGMAAQEERLDKYPSSTGRDEKGSGVYNLSNPNEQTGNPEVPPISASDDG
FT                   GEAAASNRNKDEPDDDDPFSKRRRMEGAMEITPLVKPIREPRVVVQTLSEVDILDDGYR
FT                   WRKYGQKVVRGNPNPRSYYKCTAHGCPVRKHVERASHDPKAVITTYEGKHDHDVPTSKS
FT                   SSNHEIQPRFRPDETDTISLNLGVGISSDGPNHASNEHQHQNQQLVNQTHPNGVNFRFV
FT                   HASPMSSYYASLNSGMNQYGQRETKNETQNGDISSLNNSSYPYPPNMGRVQSGP"
     MNPQANDRKE FQGDCSATGD LTAKHDSAGG NGGGGARYKL MSPAKLPISR STDITIPPGL        60
     SPTSFLESPV FISNIKKTVF FKTSCLLIDQ PEPSPTTGSL FKPRPVHISA SSSSYTGRGF       120
     HQNTFTEQKS SEFEFRPPAS NMVYAELGKI RSEPPVHFQG QGHGSSHSPS SISDAAGSSS       180
     ELSRPTPPCQ MTPTSSDIPA GSDQEESIQT SQNDSRGSTP SILADDGYNW RKYGQKHVKG       240
     SEFPRSYYKC THPNCEVKKL FERSHDGQIT DIIYKGTHDH PKPQPGRRNS GGMAAQEERL       300
     DKYPSSTGRD EKGSGVYNLS NPNEQTGNPE VPPISASDDG GEAAASNRNK DEPDDDDPFS       360
     KRRRMEGAME ITPLVKPIRE PRVVVQTLSE VDILDDGYRW RKYGQKVVRG NPNPRSYYKC       420
     TAHGCPVRKH VERASHDPKA VITTYEGKHD HDVPTSKSSS NHEIQPRFRP DETDTISLNL       480
     GVGISSDGPN HASNEHQHQN QQLVNQTHPN GVNFRFVHAS PMSSYYASLN SGMNQYGQRE       540
     TKNETQNGDI SSLNNSSYPY PPNMGRVQSG P                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page