(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26650

AL161565.AT4G26650   Location/Qualifiers
FT   CDS             join(142921..143148,143552..144670,144754..144981)
FT                   /gene="AT4g26650"
FT                   /product="hnRNP-like protein"
FT                   /note="several differences to database entry PID:e1169033"
FT                   /note="Contains Eukaryotic putative RNA-binding region
FT                   RNP-1 signature AA49-56;Eukaryotic putative RNA-binding
FT                   region RNP-1 signature AA156-163"
FT                   /note="contains EST gb:T21874, AI995401.1, Z24471"
FT                   /db_xref="GOA:Q9SU99"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034131"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SU99"
FT                   /protein_id="CAB79520.1"
FT                   /translation="MESASDLGKLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDRTT
FT                   GRARGFGFIVFADPSVAERVIMDKHIIDGRTVEAKKAVPRDDQQVLKRHASPMHLISPS
FT                   HGGNGGGARTKKIFVGGLPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITF
FT                   DSEESVDMVLHKTFHELNGKMVEVKRAVPKELSSTTPNRSPLIGYGNNYGVVPNRSSAN
FT                   SYFNSFPPGYNNNNLGSAGRFSPIGSGRNAFSSFGLGLNQELNLNSNFDGNTLGYSRIP
FT                   GNQYFNSASPNRYNSPIGYNRGDSAYNPSNRDLWGNRSDSSGPGWNLGVSVGNNRGNWG
FT                   LSSVVSDNNGYGRSYGAGSGLSGLSFAGNTNGFDGSIGELYRGSSVYSDSTWQQSMPHH
FT                   QSSNELDGLSRSYGFGIDNVGSDPSANASEGYSGNYNVGNRQTHRGTLIDVLKHRKKST
FT                   KRSENCRSRRTAISVAEFEELLFRYQVEKETNFLHHSEFLVLFFSSLASQTQKREVYFY
FT                   FKNSYIR"
     MESASDLGKL FIGGISWDTD EERLQEYFGK YGDLVEAVIM RDRTTGRARG FGFIVFADPS        60
     VAERVIMDKH IIDGRTVEAK KAVPRDDQQV LKRHASPMHL ISPSHGGNGG GARTKKIFVG       120
     GLPSSITEAE FKNYFDQFGT IADVVVMYDH NTQRPRGFGF ITFDSEESVD MVLHKTFHEL       180
     NGKMVEVKRA VPKELSSTTP NRSPLIGYGN NYGVVPNRSS ANSYFNSFPP GYNNNNLGSA       240
     GRFSPIGSGR NAFSSFGLGL NQELNLNSNF DGNTLGYSRI PGNQYFNSAS PNRYNSPIGY       300
     NRGDSAYNPS NRDLWGNRSD SSGPGWNLGV SVGNNRGNWG LSSVVSDNNG YGRSYGAGSG       360
     LSGLSFAGNT NGFDGSIGEL YRGSSVYSDS TWQQSMPHHQ SSNELDGLSR SYGFGIDNVG       420
     SDPSANASEG YSGNYNVGNR QTHRGTLIDV LKHRKKSTKR SENCRSRRTA ISVAEFEELL       480
     FRYQVEKETN FLHHSEFLVL FFSSLASQTQ KREVYFYFKN SYIR                        524
//

If you have problems or comments...

PBIL Back to PBIL home page