(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26660

AL161565.AT4G26660   Location/Qualifiers
FT   CDS             join(145929..146186,146310..146480,146599..147456,
FT                   147555..147641,147849..148616,148711..148989)
FT                   /gene="AT4g26660"
FT                   /product="putative protein"
FT                   /note="similarity to probable kinesin - Arabidopsis
FT                   thaliana, Pir2:H71402"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA219-229"
FT                   /note="contains EST gb:AI998850.1"
FT                   /db_xref="GOA:Q9SU98"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SU98"
FT                   /protein_id="CAB79521.1"
FT                   /translation="MKSPAILSENRFLGSITSSSIRNLLPKSISGKQKPIIQNPDTKIP
FT                   RSNDENAIPVDPNQKASDHHTALQFTKQSDSKDGNFGEPIKDNKMGQSTFAEDKRSLLD
FT                   SPLKVESRSILSRRTNSVPSEIKEEDDDDSLGDQIRELKEELIRTKSDGYNKADASKSG
FT                   HFARDSLSQLRVSINKSLLMSCPKRDESEGKEVIVDGEDVLELNKHIEKLHGSYDSVHS
FT                   SFASASCYEADSMSGDDEDVCSEDLEKPMHGNHKDVDFVDNDPSQLDNVEFDTTGSGIS
FT                   IRSQLPSCVLEEPIFSESPKFKNVQKSVAASTKFSANPRNVSESSNIGDMKVNQISPCM
FT                   SKKVSGPTDSLAASLQRGLQIIDYHQGSSLSKSSSVSFSFGHMALKPCAEGENLNASVQ
FT                   SFRKDKASEGGLSSILLCLSCRKKVDQEAEVTEEAGSNEKHLKNMCMEQAAKIEELTLL
FT                   LRKSDDGEDGTEFIKETYETKQISEEFGKTNFEVSEKEALLKEIADLKSKLQPTKSTDN
FT                   LRSSLLLRSIQMRKSIDVSRNGENSDDLAKEREMWTEMESEWISLTDDLRMDIDNHRSR
FT                   AENLEFELKQEKLATEELNDALTRAVLGHSRFIEQYTELQETYNELGEKHSVMMAGITD
FT                   VKKAASKAAMNGRHGKRFAKAFSDELSAIRAEKEKERELLKKENKNLRTQLRDTAEAVQ
FT                   AAGELLVRLRESEQALQVSEERFSVVEEEKERLKKQMEQLKSKHKTEIGTMKQYLAESK
FT                   LPGSALLQPWYKDEEDEIEQVSEHETGAVSFDDYEDDQAWRAEFGATYQDHHY"
     MKSPAILSEN RFLGSITSSS IRNLLPKSIS GKQKPIIQNP DTKIPRSNDE NAIPVDPNQK        60
     ASDHHTALQF TKQSDSKDGN FGEPIKDNKM GQSTFAEDKR SLLDSPLKVE SRSILSRRTN       120
     SVPSEIKEED DDDSLGDQIR ELKEELIRTK SDGYNKADAS KSGHFARDSL SQLRVSINKS       180
     LLMSCPKRDE SEGKEVIVDG EDVLELNKHI EKLHGSYDSV HSSFASASCY EADSMSGDDE       240
     DVCSEDLEKP MHGNHKDVDF VDNDPSQLDN VEFDTTGSGI SIRSQLPSCV LEEPIFSESP       300
     KFKNVQKSVA ASTKFSANPR NVSESSNIGD MKVNQISPCM SKKVSGPTDS LAASLQRGLQ       360
     IIDYHQGSSL SKSSSVSFSF GHMALKPCAE GENLNASVQS FRKDKASEGG LSSILLCLSC       420
     RKKVDQEAEV TEEAGSNEKH LKNMCMEQAA KIEELTLLLR KSDDGEDGTE FIKETYETKQ       480
     ISEEFGKTNF EVSEKEALLK EIADLKSKLQ PTKSTDNLRS SLLLRSIQMR KSIDVSRNGE       540
     NSDDLAKERE MWTEMESEWI SLTDDLRMDI DNHRSRAENL EFELKQEKLA TEELNDALTR       600
     AVLGHSRFIE QYTELQETYN ELGEKHSVMM AGITDVKKAA SKAAMNGRHG KRFAKAFSDE       660
     LSAIRAEKEK ERELLKKENK NLRTQLRDTA EAVQAAGELL VRLRESEQAL QVSEERFSVV       720
     EEEKERLKKQ MEQLKSKHKT EIGTMKQYLA ESKLPGSALL QPWYKDEEDE IEQVSEHETG       780
     AVSFDDYEDD QAWRAEFGAT YQDHHY                                            806
//

If you have problems or comments...

PBIL Back to PBIL home page