(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26670

AL161565.AT4G26670   Location/Qualifiers
FT   CDS             join(149432..149633,150029..150087,150168..150240,
FT                   150342..150395,150516..150754)
FT                   /gene="AT4g26670"
FT                   /product="putative protein"
FT                   /note="weak similarity to probable membrane protein YDL217c
FT                   - yeast, EMBL:Z74265"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA129-139"
FT                   /note="contains EST gb:AA404844, T46407"
FT                   /db_xref="GOA:Q94EH2"
FT                   /db_xref="InterPro:IPR039175"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q94EH2"
FT                   /protein_id="CAB79522.1"
FT                   /translation="MAANDSSNAIDIDGNLDSDSNLNTDGDEATDNDSSKALVTIPAPA
FT                   VCLFRFAGDAAGGAVMGSIFGYGLFKKKGFKGSFADAGQSAKTFAVLSGVHSLVVCLLK
FT                   QIRGKDDAINVGVAGCCTGLALSFPGAPQALLQSCLTFGAFSFILEGLNKRQTALAHSV
FT                   SLRHQTGLFQDHHRALPLSLALPIPEEIKGAFSSFCKSLAKPRKF"
     MAANDSSNAI DIDGNLDSDS NLNTDGDEAT DNDSSKALVT IPAPAVCLFR FAGDAAGGAV        60
     MGSIFGYGLF KKKGFKGSFA DAGQSAKTFA VLSGVHSLVV CLLKQIRGKD DAINVGVAGC       120
     CTGLALSFPG APQALLQSCL TFGAFSFILE GLNKRQTALA HSVSLRHQTG LFQDHHRALP       180
     LSLALPIPEE IKGAFSSFCK SLAKPRKF                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page