(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26680

AL161565.AT4G26680   Location/Qualifiers
FT   CDS             152028..153593
FT                   /gene="AT4g26680"
FT                   /product="putative protein"
FT                   /note="similarity to other putative proteins from
FT                   Arabidopsis"
FT                   /note="contains EST gb:AA395033, Z34229"
FT                   /db_xref="GOA:Q9SZ10"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZ10"
FT                   /protein_id="CAB79523.1"
FT                   /translation="MIRISIGVNRRLRYQFSSFAGYSGSENPRLFKTLGAANTPIPHRR
FT                   NPEPKGQDLDFVNVAHSHLIQSDWDKLNKLSDHLDSFRVKNVLLKIQKDYLLSLEFFNW
FT                   AKTRNPGSHSLETHAIVLHTLTKNRKFKSAESILRDVLVNGGVDLPAKVFDALLYSYRE
FT                   CDSTPRVFDSLFKTFAHLKKFRNATDTFMQMKDYGFLPTVESCNAYMSSLLGQGRVDIA
FT                   LRFYREMRRCKISPNPYTLNMVMSGYCRSGKLDKGIELLQDMERLGFRATDVSYNTLIA
FT                   GHCEKGLLSSALKLKNMMGKSGLQPNVVTFNTLIHGFCRAMKLQEASKVFGEMKAVNVA
FT                   PNTVTYNTLINGYSQQGDHEMAFRFYEDMVCNGIQRDILTYNALIFGLCKQAKTRKAAQ
FT                   FVKELDKENLVPNSSTFSALIMGQCVRKNADRGFELYKSMIRSGCHPNEQTFNMLVSAF
FT                   CRNEDFDGASQVLREMVRRSIPLDSRTVHQVCNGLKHQGKDQLVKKLLQEMEGKKFLQE
FT                   SFNN"
     MIRISIGVNR RLRYQFSSFA GYSGSENPRL FKTLGAANTP IPHRRNPEPK GQDLDFVNVA        60
     HSHLIQSDWD KLNKLSDHLD SFRVKNVLLK IQKDYLLSLE FFNWAKTRNP GSHSLETHAI       120
     VLHTLTKNRK FKSAESILRD VLVNGGVDLP AKVFDALLYS YRECDSTPRV FDSLFKTFAH       180
     LKKFRNATDT FMQMKDYGFL PTVESCNAYM SSLLGQGRVD IALRFYREMR RCKISPNPYT       240
     LNMVMSGYCR SGKLDKGIEL LQDMERLGFR ATDVSYNTLI AGHCEKGLLS SALKLKNMMG       300
     KSGLQPNVVT FNTLIHGFCR AMKLQEASKV FGEMKAVNVA PNTVTYNTLI NGYSQQGDHE       360
     MAFRFYEDMV CNGIQRDILT YNALIFGLCK QAKTRKAAQF VKELDKENLV PNSSTFSALI       420
     MGQCVRKNAD RGFELYKSMI RSGCHPNEQT FNMLVSAFCR NEDFDGASQV LREMVRRSIP       480
     LDSRTVHQVC NGLKHQGKDQ LVKKLLQEME GKKFLQESFN N                           521
//

If you have problems or comments...

PBIL Back to PBIL home page