(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26690

AL161565.AT4G26690   Location/Qualifiers
FT   CDS             complement(join(153968..154263,154346..154829,
FT                   154930..155072,155273..155557,155650..155688,
FT                   155784..156401,156477..156770,156945..157076,
FT                   157710..157731))
FT                   /gene="AT4g26690"
FT                   /product="putative protein"
FT                   /note="weak similarity to hypothetical protein PFB0835c -
FT                   malaria, PID:g3845289"
FT                   /note="contains EST gb:AI994396.1, T42321, R65259,
FT                   AA720169, R64793"
FT                   /db_xref="GOA:Q9SZ11"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZ11"
FT                   /protein_id="CAB79524.1"
FT                   /translation="MNANACKDNPTMRGLLRASSLLLCGVILIQLLAAQIHAQSKKPKS
FT                   PWPTLTGDPPLVIARGGFSGLFPDSSYDAYNFAILTSVPDAVLWCDVQLTKDALGICFP
FT                   DLTMRNSSSIEAVYPTRQKSYPVNGVPTSGWFTIDFSLKDLKDVNLIRGILSRSEKFDG
FT                   NSNPIMTVQSVSTQMKPSFFWLNVQHDAFYAQHNLSMSSFLVAASKTVLIDFISSPEVN
FT                   FFKKIAGRFGRNGPSLVFRFLGQDEFEPTTNRTYGSILSNLTFVKTFASGILVPKSYIL
FT                   PLDDQQYLLPHTSLVQDAHKAGLEVFVSGFANDIDIAHDYSFDPVSEYLSFVDNGNFSV
FT                   DGVLSDFPITASASLDCFSHVGRNATKQVDFLVITKDGASGDYPGCTDLAYKKAIKDGA
FT                   DVIDCSVQLSSDGTPFCLSSIDLGNSTTVSLTAFRNRSTTVPELGSLGAIYTFSLTWAE
FT                   IQTLTPAISNPYRVTSLFRNPKQKNAGKLFSLSDFLSLAKNSTSLSGVLISVENAAYLR
FT                   EEQGLDVVKAVLDTLTQTGYSNSTATKVMIQSTNSSVLVDFKKQSQYETVYKVEENIRD
FT                   ILDSAIEDIKKFADAVVIQKLSVFPVAQSFITTQTNVVEKLQKSQLPVYVELFQNEFLS
FT                   QPYDFFADATVEINSYITGAGINGTITEFPFTAARYKRNLCLGRKETIPYMAPAQPGAL
FT                   LTLVSPTAFPPAEAPNPVFTDADVTEPPLPPVTAKAPTSSPGTPSTNAQAPSGQTRITL
FT                   SLLLSVFAMVLASLLLL"
     MNANACKDNP TMRGLLRASS LLLCGVILIQ LLAAQIHAQS KKPKSPWPTL TGDPPLVIAR        60
     GGFSGLFPDS SYDAYNFAIL TSVPDAVLWC DVQLTKDALG ICFPDLTMRN SSSIEAVYPT       120
     RQKSYPVNGV PTSGWFTIDF SLKDLKDVNL IRGILSRSEK FDGNSNPIMT VQSVSTQMKP       180
     SFFWLNVQHD AFYAQHNLSM SSFLVAASKT VLIDFISSPE VNFFKKIAGR FGRNGPSLVF       240
     RFLGQDEFEP TTNRTYGSIL SNLTFVKTFA SGILVPKSYI LPLDDQQYLL PHTSLVQDAH       300
     KAGLEVFVSG FANDIDIAHD YSFDPVSEYL SFVDNGNFSV DGVLSDFPIT ASASLDCFSH       360
     VGRNATKQVD FLVITKDGAS GDYPGCTDLA YKKAIKDGAD VIDCSVQLSS DGTPFCLSSI       420
     DLGNSTTVSL TAFRNRSTTV PELGSLGAIY TFSLTWAEIQ TLTPAISNPY RVTSLFRNPK       480
     QKNAGKLFSL SDFLSLAKNS TSLSGVLISV ENAAYLREEQ GLDVVKAVLD TLTQTGYSNS       540
     TATKVMIQST NSSVLVDFKK QSQYETVYKV EENIRDILDS AIEDIKKFAD AVVIQKLSVF       600
     PVAQSFITTQ TNVVEKLQKS QLPVYVELFQ NEFLSQPYDF FADATVEINS YITGAGINGT       660
     ITEFPFTAAR YKRNLCLGRK ETIPYMAPAQ PGALLTLVSP TAFPPAEAPN PVFTDADVTE       720
     PPLPPVTAKA PTSSPGTPST NAQAPSGQTR ITLSLLLSVF AMVLASLLLL                  770
//

If you have problems or comments...

PBIL Back to PBIL home page