(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26700

AL161565.AT4G26700   Location/Qualifiers
FT   CDS             join(160935..161021,161095..161265,161365..161606,
FT                   161692..161863,161976..162014,162096..162164,
FT                   162245..162361,162649..162860,163134..163286,
FT                   163428..163627,163726..163883,163983..164079,
FT                   164174..164265,164347..164601)
FT                   /gene="AT4g26700"
FT                   /product="fimbrin-like protein (ATFIM1)"
FT                   /note="one AA substitution to fimbrin-like protein -
FT                   Arabidopsis thaliana, PID:g2905893"
FT                   /note="nearly identical with fimbrin 1, PID:g2811230,
FT                   partial CDS"
FT                   /note="contains EST gb:Z29761, Z29762"
FT                   /db_xref="GOA:Q7G188"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="InterPro:IPR039959"
FT                   /db_xref="PDB:1PXY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7G188"
FT                   /protein_id="CAB79525.1"
FT                   /translation="MSGYVGVVVSDPWLQSQFTQVELRTLNSKYVSVKNQNGKVTIEDL
FT                   PPLFAKLKALSATFKEDEIKGMLGELGSDTSTDVSFEEFLKIYLNLLSKAAEKSGGHHK
FT                   NSSSFLKACTTTLLHTIYQSEKGPFVQHINRYLGDDPFLKQFLPLDPHSNQLYELVKDG
FT                   VLLCKLINVAVPGTIDERAINTKRVLNPWERNENHTLCLNSAKAVGCSVVNIGTQDLAE
FT                   GRPHLVLGLISQLIKIQVLADLNLKKTPQLVELLEDSDDVEELLRLPPEKVLLKWMNFH
FT                   LKKGGYKKTVSNFSADLKDAQAYAFLLNVLAPEHCDPATLDAKDPLERAELVLSHAERM
FT                   NCKRYLTAEEIVEGSSTLNLAFVAQIFHERNGLNKDGKYAFAEMMTEDVETCRDERCYR
FT                   LWINSLGIDSYVNNVFEDVRNGWILLEVLDKVSPSSVNWKHASKPPIKMPFRKVENCNQ
FT                   VIKIGKQLKFSLVNVAGNDIVQGNKKLILGLLWQLMRFHMLQLLKSLRSRTLGKEMTDA
FT                   DILSWANRKVRTMGRKLQIESFKDKSLSSGLFFLNLLWAVEPRVVNWNLVTKGETDDEK
FT                   RLNATYIVSVARKLGCSVFLLPEDIVEVNQKMILILTASIMYWSLQRHSRESSDSSSTQ
FT                   STTTTCTSTASSPAPSVTEEEEVSSLSGEVTSLAVGDAVSEITTVSEEASIE"
     MSGYVGVVVS DPWLQSQFTQ VELRTLNSKY VSVKNQNGKV TIEDLPPLFA KLKALSATFK        60
     EDEIKGMLGE LGSDTSTDVS FEEFLKIYLN LLSKAAEKSG GHHKNSSSFL KACTTTLLHT       120
     IYQSEKGPFV QHINRYLGDD PFLKQFLPLD PHSNQLYELV KDGVLLCKLI NVAVPGTIDE       180
     RAINTKRVLN PWERNENHTL CLNSAKAVGC SVVNIGTQDL AEGRPHLVLG LISQLIKIQV       240
     LADLNLKKTP QLVELLEDSD DVEELLRLPP EKVLLKWMNF HLKKGGYKKT VSNFSADLKD       300
     AQAYAFLLNV LAPEHCDPAT LDAKDPLERA ELVLSHAERM NCKRYLTAEE IVEGSSTLNL       360
     AFVAQIFHER NGLNKDGKYA FAEMMTEDVE TCRDERCYRL WINSLGIDSY VNNVFEDVRN       420
     GWILLEVLDK VSPSSVNWKH ASKPPIKMPF RKVENCNQVI KIGKQLKFSL VNVAGNDIVQ       480
     GNKKLILGLL WQLMRFHMLQ LLKSLRSRTL GKEMTDADIL SWANRKVRTM GRKLQIESFK       540
     DKSLSSGLFF LNLLWAVEPR VVNWNLVTKG ETDDEKRLNA TYIVSVARKL GCSVFLLPED       600
     IVEVNQKMIL ILTASIMYWS LQRHSRESSD SSSTQSTTTT CTSTASSPAP SVTEEEEVSS       660
     LSGEVTSLAV GDAVSEITTV SEEASIE                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page