(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26710

AL161565.AT4G26710   Location/Qualifiers
FT   CDS             join(165880..165977,166328..166375,166777..166843)
FT                   /gene="AT4g26710"
FT                   /product="putative protein"
FT                   /note="EST Z35392 covers intron in 5' untranslated region"
FT                   /note="contains EST gb:AI997240.1, Z25573, T44952, Z35392,
FT                   Z17955"
FT                   /db_xref="GOA:Q9SZ13"
FT                   /db_xref="InterPro:IPR008389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZ13"
FT                   /protein_id="CAB79526.1"
FT                   /translation="MAFVVTSLIFAVVGIIASICTRICFNKGPSTNLLHLTLVITATVC
FT                   CWMMWAIVYIAQMNPLIVPILSEVE"
     MAFVVTSLIF AVVGIIASIC TRICFNKGPS TNLLHLTLVI TATVCCWMMW AIVYIAQMNP        60
     LIVPILSEVE                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page