(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26720

AL161565.AT4G26720   Location/Qualifiers
FT   CDS             complement(join(167572..167622,167705..167783,
FT                   167874..168142,168226..168301,168390..168475,
FT                   168554..168616,168727..168879,169189..169329))
FT                   /gene="AT4g26720"
FT                   /product="phosphoprotein phosphatase (PPX-1)"
FT                   /note="Contains Serine/threonine specific protein
FT                   phosphatases signature AA108-113"
FT                   /note="contains EST gb:H77057, N37575, T44811, AI992913.1,
FT                   T43788, H77152, AW004364.1, AI996959.1, R29983, R29984,
FT                   H36585, N37622, T42314, T41959, T41565, AA042143"
FT                   /db_xref="GOA:P48529"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48529"
FT                   /protein_id="CAB79527.1"
FT                   /translation="MSDLDRQIGQLKRCEPLSESEVKALCLKAMEILVEESNVQRVDAP
FT                   VTLCGDIHGQFYDMMELFKVGGDCPKTNYLFMGDFVDRGYYSVETFLLLLALKVRYPDR
FT                   ITLIRGNHESRQITQVYGFYDECLRKYGSSNVWRYCTDIFDYMSLSAVVENKIFCVHGG
FT                   LSPAIMTLDQIRTIDRKQEVPHDGAMCDLLWSDPEDIVDGWGLSPRGAGFLFGGSVVTS
FT                   FNHSNNIDYIARAHQLVMEGYKWMFDSQIVTVWSAPNYCYRCGNVASILELDENLNKEF
FT                   RVFDAAQQDSRGPPAKKPAPDYFL"
     MSDLDRQIGQ LKRCEPLSES EVKALCLKAM EILVEESNVQ RVDAPVTLCG DIHGQFYDMM        60
     ELFKVGGDCP KTNYLFMGDF VDRGYYSVET FLLLLALKVR YPDRITLIRG NHESRQITQV       120
     YGFYDECLRK YGSSNVWRYC TDIFDYMSLS AVVENKIFCV HGGLSPAIMT LDQIRTIDRK       180
     QEVPHDGAMC DLLWSDPEDI VDGWGLSPRG AGFLFGGSVV TSFNHSNNID YIARAHQLVM       240
     EGYKWMFDSQ IVTVWSAPNY CYRCGNVASI LELDENLNKE FRVFDAAQQD SRGPPAKKPA       300
     PDYFL                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page