(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26730

AL161565.AT4G26730   Location/Qualifiers
FT   CDS             join(169754..169825,169930..170484)
FT                   /gene="AT4g26730"
FT                   /product="putative protein"
FT                   /note="similarity to H+-transporting ATP synthase, (EC
FT                   3.6.1.34) chain a - Synechocystis, GB:AB001339"
FT                   /db_xref="GOA:Q9SZ14"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SZ14"
FT                   /protein_id="CAB79528.1"
FT                   /translation="MERNVEKMLNRVSVVFLSIGTVLMHLPLPKKNARIWFSGAWKSRL
FT                   SSFSTYFLRFRDLGFIQNHTKALCLSDGAGHAPMALSQIGLSDVTAVELVDSIPLVKRA
FT                   DPHNLPFFDRVFDFVFTAHLAEALFPWRFVEEMERTVRRGGFCVVAVDECSGDDVRDIA
FT                   RFFHNSKIVDVANVTLERVKRTSILFKLQDSKRTSILFKVQDSLS"
     MERNVEKMLN RVSVVFLSIG TVLMHLPLPK KNARIWFSGA WKSRLSSFST YFLRFRDLGF        60
     IQNHTKALCL SDGAGHAPMA LSQIGLSDVT AVELVDSIPL VKRADPHNLP FFDRVFDFVF       120
     TAHLAEALFP WRFVEEMERT VRRGGFCVVA VDECSGDDVR DIARFFHNSK IVDVANVTLE       180
     RVKRTSILFK LQDSKRTSIL FKVQDSLS                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page