(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26740

AL161565.AT4G26740   Location/Qualifiers
FT   CDS             complement(join(170966..171128,171255..171380,
FT                   171471..171565,171690..171775,171865..172014,
FT                   172336..172453))
FT                   /gene="AT4g26740"
FT                   /product="embryo-specific protein 1 (ATS1)"
FT                   /note="contains EST gb:Z27053, Z29900"
FT                   /db_xref="GOA:O81270"
FT                   /db_xref="InterPro:IPR007736"
FT                   /db_xref="UniProtKB/Swiss-Prot:O81270"
FT                   /protein_id="CAB79529.1"
FT                   /translation="MGSKTEMMERDAMATVAPYAPVTYHRRARVDLDDRLPKPYMPRAL
FT                   QAPDREHPYGTPGHKNYGLSVLQQHVSFFDIDDNGIIYPWETYSGLRMLGFNIIGSLII
FT                   AAVINLTLSYATLPGWLPSPFFPIYIHNIHKSKHGSDSKTYDNEGRFMPVNLELIFSKY
FT                   AKTLPDKLSLGELWEMTEGNRDAWDIFGWIAGKIEWGLLYLLARDEEGFLSKEAIRRCF
FT                   DGSLFEYCAKIYAGISEDKTAYY"
     MGSKTEMMER DAMATVAPYA PVTYHRRARV DLDDRLPKPY MPRALQAPDR EHPYGTPGHK        60
     NYGLSVLQQH VSFFDIDDNG IIYPWETYSG LRMLGFNIIG SLIIAAVINL TLSYATLPGW       120
     LPSPFFPIYI HNIHKSKHGS DSKTYDNEGR FMPVNLELIF SKYAKTLPDK LSLGELWEMT       180
     EGNRDAWDIF GWIAGKIEWG LLYLLARDEE GFLSKEAIRR CFDGSLFEYC AKIYAGISED       240
     KTAYY                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page