(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26750

AL161565.AT4G26750   Location/Qualifiers
FT   CDS             complement(join(173023..173763,174034..174177,
FT                   174278..174353,174869..174978,175278..175378,
FT                   175464..175557))
FT                   /gene="AT4g26750"
FT                   /product="putative protein"
FT                   /note="similarity to extensin precursor - tomato,
FT                   Pir2:S25299"
FT                   /note="contains EST gb:AI994725.1, N37698, T46339,
FT                   AA404836"
FT                   /db_xref="GOA:Q9SZ15"
FT                   /db_xref="InterPro:IPR023175"
FT                   /db_xref="InterPro:IPR039431"
FT                   /db_xref="InterPro:IPR041212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZ15"
FT                   /protein_id="CAB79530.1"
FT                   /translation="MSNPNEPARALLPYLQRADELQKHEPLVAYYCRLYAMERGLKIPQ
FT                   SERTKTTNSILMSLINQLEKDKKSLTLSPDDNMHVEGFALSVFAKADKQDRAGRADLGT
FT                   AKTFYAASIFFEILSQFGPVPPDIEQKHKYAAWKAADIRKAIKEGRKPTPGDPVDDDTD
FT                   LSIPSSGPSGSYDHSASDTNTTSHHRTELDPPHDSNDDSSHHQFPEVPQHPLPPRFYDN
FT                   PTNDYPADVPPPPPSSYPSNDHLPPPTGPSDSPYPHPYSHQPYHQDPPKHMPPPQNYSS
FT                   HEPSPNSLPNFQSYPSFSESSLPSTSPHYPSHYQNPEPYYSSPHSAPAPSSTSFSSAPP
FT                   PPPYSSNGRINIAPVLDPAPSSAQKYHYDSSYQPGPEKVAEALKAARFAVGALAFDEVS
FT                   TAVEHLKKSLELLTNPSAGAGH"
     MSNPNEPARA LLPYLQRADE LQKHEPLVAY YCRLYAMERG LKIPQSERTK TTNSILMSLI        60
     NQLEKDKKSL TLSPDDNMHV EGFALSVFAK ADKQDRAGRA DLGTAKTFYA ASIFFEILSQ       120
     FGPVPPDIEQ KHKYAAWKAA DIRKAIKEGR KPTPGDPVDD DTDLSIPSSG PSGSYDHSAS       180
     DTNTTSHHRT ELDPPHDSND DSSHHQFPEV PQHPLPPRFY DNPTNDYPAD VPPPPPSSYP       240
     SNDHLPPPTG PSDSPYPHPY SHQPYHQDPP KHMPPPQNYS SHEPSPNSLP NFQSYPSFSE       300
     SSLPSTSPHY PSHYQNPEPY YSSPHSAPAP SSTSFSSAPP PPPYSSNGRI NIAPVLDPAP       360
     SSAQKYHYDS SYQPGPEKVA EALKAARFAV GALAFDEVST AVEHLKKSLE LLTNPSAGAG       420
     H                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page