(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26760

AL161565.AT4G26760   Location/Qualifiers
FT   CDS             complement(join(176519..176704,176798..177109,
FT                   177187..177342,177505..177720,177797..178072,
FT                   178127..178330,178404..178475))
FT                   /gene="AT4g26760"
FT                   /product="putative protein"
FT                   /note="similarity to hypothetical protein, Arabidopsis
FT                   thaliana chromosome II BAC T6A23, PID:g3786000"
FT                   /note="contains EST gb:AI992936.1, T41951, R30266"
FT                   /db_xref="GOA:Q8LEG3"
FT                   /db_xref="InterPro:IPR007145"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LEG3"
FT                   /protein_id="CAB79531.1"
FT                   /translation="MAVTEAENPLLGEITCGTLLQKLQEIWDEVGESDEERDKLLLQIE
FT                   EECLNVYKKKVELAAKSRAELLQTLSDATVELSNLTTALGEKSYIDICDSMSLFPLQPD
FT                   KTSGTIKEQLSAIAPALEQLWQQKEERVRAFSDVQSQIQKICEEIAGGLNNGPHVVDET
FT                   DLSLKRLDDFQRKLQELQKEKSDRLQKVLEFVSTVHDLCAVLRLDFLSTVTEVHPSLDE
FT                   ANGVQTKSISNETLARLAKTVLTLKEDKMQRLKKLQELATQLTDLWNLMDTSDEERELF
FT                   DHVTSNISASVHEVTASGALALDLIEQAEVEVDRLDQLKSSRMKEIAFKKQSELEEIYA
FT                   RAHIEIKPEVVRERIMSLIDAGNTEPTELLADMDSQIAKAKEEAFSRKEILDRVEKWMS
FT                   ACEEESWLEDYNRDQNRYSASRGAHLNLKRAEKARILVSKITGKNFQKSLLVITTHRIK
FT                   LRLKNISYFVCASYG"
     MAVTEAENPL LGEITCGTLL QKLQEIWDEV GESDEERDKL LLQIEEECLN VYKKKVELAA        60
     KSRAELLQTL SDATVELSNL TTALGEKSYI DICDSMSLFP LQPDKTSGTI KEQLSAIAPA       120
     LEQLWQQKEE RVRAFSDVQS QIQKICEEIA GGLNNGPHVV DETDLSLKRL DDFQRKLQEL       180
     QKEKSDRLQK VLEFVSTVHD LCAVLRLDFL STVTEVHPSL DEANGVQTKS ISNETLARLA       240
     KTVLTLKEDK MQRLKKLQEL ATQLTDLWNL MDTSDEEREL FDHVTSNISA SVHEVTASGA       300
     LALDLIEQAE VEVDRLDQLK SSRMKEIAFK KQSELEEIYA RAHIEIKPEV VRERIMSLID       360
     AGNTEPTELL ADMDSQIAKA KEEAFSRKEI LDRVEKWMSA CEEESWLEDY NRDQNRYSAS       420
     RGAHLNLKRA EKARILVSKI TGKNFQKSLL VITTHRIKLR LKNISYFVCA SYG              473
//

If you have problems or comments...

PBIL Back to PBIL home page